Table I.

Wild-type and high affinity TCR specific for HLA-A2 complexed NY-ESO-1157–165a

CloneCDR2αCDR3αCDR2βTCRβF3CDR3βKd 9C (nM)Kd 9V (nM)
WTIQSSQPTSGGSYIPTGAGIQGEVPNGYNVSRSTTYVGN11,7005,500
113ITPWQPLLDGTYIPT AIQT RGEVPNGYNVSRSTIYLGN0.0490.038
  • a Summary of sequence and kinetic data for wild-type and high affinity NYE(113) TCRs. Amino acid sequences are in single letter code. Sequence changes to wild type in the high affinity TCR variant are shown in bold. TCR affinities for NY-ESO-1157–165/HLA-A2 Ag were determined for both the wild-type (9C) and 9V variant peptide by SPR.