Table II.

Protein alignment of Icos and putative soluble splice varianta

ICOSMKPYFCRVFVFCFLIRLLTGEINGSADHRMFSFHNGGVQISCKY
Soluble ICOSMKPYFCRVFVFCFLIRLLTGEINGSADHRMFSFHNGGVQISCKY
ICOSPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHL
Soluble ICOSPETVQQLKMRLFREREVLCELTKTKGSGNSVSIKNPMLCLYHL
ICOSSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIY
Soluble ICOSSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIY
ICOSESQLCCQLKLWLPVGCAAFVVVLLFGCILIIWFSKKKYGSSVH
Soluble ICOS-----------------------------------EIWIQCA
ICOSDPNSEYMFMAAVNTNKKSRLAGVTS
  • Bold = transmembrane domain, underline = signal peptide, italics = different OFR.