Table I.

The leucine-rich sequence upstream of the DBD is unique to RFX5

GeneSpeciesAmino Acid Sequence Upstream of the DBD Coding Regiona
RFX5Human…KLYLYLQLPSGPTTGDKSSEPSTLSNEEYMYAYRWIR…
RFX1Human…SGSGAGTYVIQGGYMLGSASQSYSHTTRASPATVQWLL
Mouse…SGSGAGTYVIQGGYMLGNASQSYSHTTRASPATVQWLL
RFX2Human…SPIVSSAGAYLIHGGMDSTRHSLAHTARSSPAT lemaienlqksegitshksgllnsh LQWLL…
Mouse…TPIVSGAGAYLIHGGMDGTRHSLAHTARSSPATLQWLL
RFX3Human…QLISSSGGTYLIGNSMENSGHSVIHTTRASPAT iemaietlqksdglsthrssllnshLQWLL
Mouse…IGNSMENSGHSVTHTTRASPAT iemaietlqksdglsthrssllnshLQWLL
RFX4Human…LRKCYEVGMMKGDEEKENNRASKPHSTPATLQWLE
  • a Underlined bold lettering represents the RFX5 unique leucine-rich segment. b Italic lettering denotes the start of the DBD. c Lowercase lettering indicates the presence of an alternatively spliced segment.