Skip to main content

Main menu

  • Home
  • Articles
    • Current Issue
    • Next in The JI
    • Archive
    • Brief Reviews
    • Pillars of Immunology
    • Translating Immunology
    • Most Read
    • Top Downloads
    • Annual Meeting Abstracts
  • COVID-19/SARS/MERS Articles
  • Info
    • About the Journal
    • For Authors
    • Journal Policies
    • Influence Statement
    • For Advertisers
  • Editors
  • Submit
    • Submit a Manuscript
    • Instructions for Authors
    • Journal Policies
  • Subscribe
    • Journal Subscriptions
    • Email Alerts
    • RSS Feeds
    • ImmunoCasts
  • More
    • Most Read
    • Most Cited
    • ImmunoCasts
    • AAI Disclaimer
    • Feedback
    • Help
    • Accessibility Statement
  • Other Publications
    • American Association of Immunologists
    • ImmunoHorizons

User menu

  • Subscribe
  • Log in

Search

  • Advanced search
The Journal of Immunology
  • Other Publications
    • American Association of Immunologists
    • ImmunoHorizons
  • Subscribe
  • Log in
The Journal of Immunology

Advanced Search

  • Home
  • Articles
    • Current Issue
    • Next in The JI
    • Archive
    • Brief Reviews
    • Pillars of Immunology
    • Translating Immunology
    • Most Read
    • Top Downloads
    • Annual Meeting Abstracts
  • COVID-19/SARS/MERS Articles
  • Info
    • About the Journal
    • For Authors
    • Journal Policies
    • Influence Statement
    • For Advertisers
  • Editors
  • Submit
    • Submit a Manuscript
    • Instructions for Authors
    • Journal Policies
  • Subscribe
    • Journal Subscriptions
    • Email Alerts
    • RSS Feeds
    • ImmunoCasts
  • More
    • Most Read
    • Most Cited
    • ImmunoCasts
    • AAI Disclaimer
    • Feedback
    • Help
    • Accessibility Statement
  • Follow The Journal of Immunology on Twitter
  • Follow The Journal of Immunology on RSS

Nck Binds to the T Cell Antigen Receptor Using Its SH3.1 and SH2 Domains in a Cooperative Manner, Promoting TCR Functioning

Pussadee Paensuwan, Frederike A. Hartl, O. Sascha Yousefi, Jatuporn Ngoenkam, Piyamaporn Wipa, Esmeralda Beck-Garcia, Elaine P. Dopfer, Boonruang Khamsri, Donruedee Sanguansermsri, Susana Minguet, Wolfgang W. Schamel and Sutatip Pongcharoen
J Immunol January 1, 2016, 196 (1) 448-458; DOI: https://doi.org/10.4049/jimmunol.1500958
Pussadee Paensuwan
*Department of Microbiology and Parasitology, Faculty of Medical Science, Naresuan University, Phitsanulok 65000, Thailand;
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Frederike A. Hartl
†Department of Molecular Immunology, Faculty of Biology, BIOSS Centre for Biological Signaling Studies and Centre of Chronic Immunodeficiency, University of Freiburg, Freiburg 79108, Germany;
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
O. Sascha Yousefi
†Department of Molecular Immunology, Faculty of Biology, BIOSS Centre for Biological Signaling Studies and Centre of Chronic Immunodeficiency, University of Freiburg, Freiburg 79108, Germany;
‡Spemann Graduate School of Biology and Medicine, Albert Ludwigs University Freiburg, Freiburg 79104, Germany;
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
  • ORCID record for O. Sascha Yousefi
Jatuporn Ngoenkam
*Department of Microbiology and Parasitology, Faculty of Medical Science, Naresuan University, Phitsanulok 65000, Thailand;
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Piyamaporn Wipa
*Department of Microbiology and Parasitology, Faculty of Medical Science, Naresuan University, Phitsanulok 65000, Thailand;
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Esmeralda Beck-Garcia
†Department of Molecular Immunology, Faculty of Biology, BIOSS Centre for Biological Signaling Studies and Centre of Chronic Immunodeficiency, University of Freiburg, Freiburg 79108, Germany;
§International Max Planck Research School for Molecular and Cellular Biology, Freiburg 79108, Germany;
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Elaine P. Dopfer
†Department of Molecular Immunology, Faculty of Biology, BIOSS Centre for Biological Signaling Studies and Centre of Chronic Immunodeficiency, University of Freiburg, Freiburg 79108, Germany;
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Boonruang Khamsri
*Department of Microbiology and Parasitology, Faculty of Medical Science, Naresuan University, Phitsanulok 65000, Thailand;
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Donruedee Sanguansermsri
*Department of Microbiology and Parasitology, Faculty of Medical Science, Naresuan University, Phitsanulok 65000, Thailand;
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Susana Minguet
†Department of Molecular Immunology, Faculty of Biology, BIOSS Centre for Biological Signaling Studies and Centre of Chronic Immunodeficiency, University of Freiburg, Freiburg 79108, Germany;
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Wolfgang W. Schamel
†Department of Molecular Immunology, Faculty of Biology, BIOSS Centre for Biological Signaling Studies and Centre of Chronic Immunodeficiency, University of Freiburg, Freiburg 79108, Germany;
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Sutatip Pongcharoen
¶Centre of Excellence in Medical Biotechnology, Faculty of Medical Science, Naresuan University, Phitsanulok 65000, Thailand;
‖Research Center for Academic Excellence in Petroleum, Petrochemical and Advanced Materials, Faculty of Science, Naresuan University, Phitsanulok 65000, Thailand; and
#Department of Medicine, Faculty of Medicine, Naresuan University, Phitsanulok 65000, Thailand
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
  • Article
  • Figures & Data
  • Info & Metrics
  • PDF + SI
  • PDF
Loading

This article has a correction. Please see:

  • Errata - June 01, 2016

Abstract

Ligand binding to the TCR causes a conformational change at the CD3 subunits to expose the CD3ε cytoplasmic proline-rich sequence (PRS). It was suggested that the PRS is important for TCR signaling and T cell activation. It has been shown that the purified, recombinant SH3.1 domain of the adaptor molecule noncatalytic region of tyrosine kinase (Nck) can bind to the exposed PRS of CD3ε, but the molecular mechanism of how full-length Nck binds to the TCR in cells has not been investigated so far. Using the in situ proximity ligation assay and copurifications, we show that the binding of Nck to the TCR requires partial phosphorylation of CD3ε, as it is based on two cooperating interactions. First, the SH3.1(Nck) domain has to bind to the nonphosphorylated and exposed PRS, that is, the first ITAM tyrosine has to be in the unphosphorylated state. Second, the SH2(Nck) domain has to bind to the second ITAM tyrosine in the phosphorylated state. Likewise, mutations of the SH3.1 and SH2 domains in Nck1 resulted in the loss of Nck1 binding to the TCR. Furthermore, expression of an SH3.1-mutated Nck impaired TCR signaling and T cell activation. Our data suggest that the exact pattern of CD3ε phosphorylation is critical for TCR functioning.

Introduction

Noncatalytic region of tyrosine kinase (Nck) is a ubiquitously expressed adapter protein that is composed of three SH3 domains (SH3.1, SH3.2, and SH3.3) and one SH2 domain, and thus it potentially interacts with proline-rich sequence (PRS)–bearing proteins and tyrosine phosphorylated proteins (1). In humans, two Nck isoforms exist (Nck1/Nckα and Nck2/Nckβ), which share 68% amino acid identity (2). Nck plays a pivotal role in actin reorganization, cell movement, and cell adhesion (3). Nck also acts as a linker for the recruitment and activation of other proteins in multiple intracellular signaling pathways (1, 2).

In αβ T cells, the TCR contains the TCRαβ heterodimer, which is responsible for Ag, that is, peptide–MHC, recognition. This heterodimer is noncovalently associated with two CD3 dimers (CD3δε, CD3γε) and a ζζ dimer, which are responsible for signal transduction (4, 5). The TCR bears 10 ITAMs (YXXl/I–X6–8,YXXL/I) (6), a single ITAM in each CD3ε, CD3γ, and CD3δ, and three ITAMs in the ζ-chains (7). The phosphorylation of the tyrosine residues in the ITAMs can be promoted by the Src family kinase Lck and Fyn, resulting in the initiation of downstream signaling cascades (8). The doubly phosphorylated ITAMs recruit the tyrosine kinase ZAP70 by its tandem SH2 domains. Subsequently, ZAP70 phosphorylates adaptor proteins, such as SLP-76 and LAT (9, 10), thereby promoting signaling events, as for example Ca2+ mobilization and Erk and PI3K/Akt pathway activation. Phosphorylated SLP-76 can bind to the SH2 domain of Nck [SH2(Nck)], recruiting Nck to the “SLP-76 signalosome” (10–12).

It has been suggested that the TCR exists in two reversible conformations: the Ag-induced or “active conformation” and the “inactive conformation” adopted by nonengaged TCRs (13, 14). The peptide–MHC- or anti-TCR/CD3 Ab–induced conformational change at CD3 is required for TCR functioning (15, 16). For example, expressing a mutant CD3ε chain, in which a point mutation in the extracellular part inhibits the switch to the active conformation, results in a block of T cell activation (16) and T cell development (17).

In the active TCR conformation, the PRS in the cytoplasmic tail of CD3ε is exposed, and only in this conformation can the SH3.1 domain of Nck [SH3.1(Nck)] bind to the CD3ε PRS, as shown in a pull-down assay using a recombinant GST-SH3.1(Nck) fusion protein (13, 16, 18–22). Using biochemical approaches, it has been proposed that the recruitment of Nck to the TCR occurs earlier and independently of tyrosine phosphorylation (13). Another report has demonstrated that tyrosine phosphorylation is required for Nck recruitment to the plasma membrane (11); however, whether it was recruited to the TCR, to SLP-76, or to any other proteins remained unresolved. Whether tyrosine phosphorylation is needed for Nck recruitment is thus a matter of debate.

Recently, we have demonstrated that Nck1, rather than Nck2, plays a major role in TCR signaling in human cells (23). In the present work, we have focused on the functional role of Nck1 in cells conditionally lacking Nck2 to investigate the molecular mechanism governing the Nck–CD3ε interaction. Our data revealed that Nck needs both the SH3.1 and SH2 domains to bind to CD3ε. The requirement of tyrosine phosphorylation for CD3ε–Nck interaction was also studied using a pull-down assay with synthetic biotinylated CD3ε cytoplasmic tail peptides to mimic different CD3ε phosphorylation patterns. We show that Nck recruitment is dependent on a specific pattern of CD3ε tyrosine phosphorylation. Taken together, we suggest that the cointeraction of the SH3.1 and SH2 domains of Nck with partially phosphorylated CD3ε is required for efficient Nck binding and TCR phosphorylation.

Materials and Methods

Reagents and Abs

In this study, the following Abs were used: rabbit anti-Nck1, phospho-AKT (S473), phospho-ERK (T202/T204), and phospho-ZAP70 (Y319) Abs were purchased from Cell Signaling Technology; the mouse anti-CD3 (OKT-3) Ab was from eBioscience; the anti-idiotypic TCR Ab (C305) was from Millipore; the anti-ZAP70 and goat anti-CD3ε M20 Abs were from Santa Cruz Biotechnology; the anti-GST Ab was from Bethyl Laboratories; the anti–streptavidin (SV)-HRPO Ab was from SouthernBiotec; and the anti–phospho-ζ Ab (pTyr142) and the inhibitor of Src family kinases PP2 were from Sigma-Aldrich (St. Louis, MO). The anti-ζ antiserum 448 and the anti–phospho-CD3ε antiserum (anti–phospho-εY1) have been described (24, 25). The below-mentioned peptides were obtained from Eurogentec: pepεPP, YWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYGLNQRAV; pepγPP, AGQDGVRQSRASDKQTLLQNEQLYQPLKDREYDQYSHLQGNQLRKK; and pepδPP, GHETGRPSGAAEVQALLKNEQLYQPLRDREDTQYSRLGGNWPRNKKS (the Y in bold is phosphorylated).

Generation of double Nck1/2 knock-down cells and Nck1 mutants

Jurkat cells were cultured and expression of Nck1 and Nck2 was silenced simultaneously as previously described (23, 26). Briefly, cells were cotransfected with 0.5 μg pLVX–short hairpin (sh)Nck1 and pLVX-shNck2. Stable double Nck1/2 knock-down cells were selected by culturing the transfected cells in medium supplemented with 1.0 μg/ml puromycin and 1 mg/ml G418. The single clone was obtained from these lines by limiting dilution. For construction of double Nck1/2 knock-down cell-expressing Nck1 mutants, human Flag-tagged Nck-1 cDNA contained in the pEBB plasmid, provided by Prof. Bruce J. Mayer (Connecticut University Health Center, Farmington, CT), was used as a mutagenesis template. The wild-type Nck1 (WT-Nck1) and its mutant constructs, SH3.1*-Nck1 (W38K) and SH2*-Nck1 (R308K), were generated from the Nck1-pEBB plasmid using sited-directed mutagenesis with the QuickChange mutagenesis kit (Stratagene) using the following primers: 5′-GTGACCATGTGGGTTCCCTCTCCGAGAAATTAGCAGC-3′ and 5′-GCTGCTAATTTCTCGGAGAGGGAACCCACATGGTCAC-3′ for WT-Nck1, 5′-GCTTCTGGATGATTCTAAGTCCAAGTGGCGAGTTCGAAATTCC-3′ and 5′-GGAATTTCGAACTCGCCACTTGGACTTAGAATCATCCAGAAGC-3′ for SH3.1*-Nck1, and 5′-GGGGATTTCCTCATTAAGGATAGTGAATCTTCGCC-3′ and 5′-GGCGAAGATTCACTATCCTTAATGAGGAAATCCCC-3′ for SH2*-Nck1. The introduction of the expected mutation was confirmed by DNA sequencing. The sites of the mutated residues have been previously indicated as being important for ligand binding (27, 28), but without effect on the binding of the other unmutated domains (29). Double Nck1/2 knockdown cells were cotransfected with either plasmid-expressing WT-Nck1, SH3.1*-Nck1, or SH2*-Nck1 and pDsRed-Monomer-Hyg-N1 (0.1 μg DNA) (Clonetech), which provides resistance to hygromycin, with an electroporator using an Amaxa Nucleofector II and the manufacturer’s protocol X-005. The transfectants were selected after 48 h in medium supplemented with 400 μg/ml hygromycin. Nck1 expression was assessed by immunoblotting. TCR expression was evaluated by flow cytometry, and for further studies, clones with similar expression levels were selected.

Cell stimulation, lysis, immunoprecipitation, and pull-down assay

Cells, including Jurkat, J.Cam1.6, as well as primary human CD4+ T cells, were harvested and starved in RPMI 1640 medium without FBS for 1 h at 37°C. Jurkat and J.Cam1.6 cells were from the American Type Culture Collection (Rockville, MD). The primary CD4+ T cells were isolated from buffy coats of the Blood Bank Centre of Naresuan University Hospital under the approval of Naresuan University Research Ethics Committee (Institutional Review Board no. 226/56). Subsequently, cells were either stimulated with the anti-TCR Ab C305 (1:50) for the indicated time points or left untreated. The Ab dilution (1:50) used in this study corresponds to ∼0.12 μg/ml C305. For pervanadate (PV) treatment, cells were stimulated 1 mM PV for the indicated time points. In some experiments, cells were pretreated with 20 μM Src kinase inhibitor PP2 for 30 min at 37°C before stimulation. Cells were then lysed in 100 μl lysis buffer (20 mM Tris-HCl [pH 8], 137 mM NaCl, 2 mM EDTA, 10% glycerol, protease inhibitor mixture [Sigma-Aldrich]), 1 mM PMSF, 5 mM iodoacetamide, 0.5 mM sodium orthovanadate, 1 mM NaF, and 0.3% Brij96V) for 30 min on ice (30). TCRs from the total cellular lysates were either immunoprecipitated with 1 μg anti-CD3ε (OKT3) Ab-coupled protein–G Sepharose beads (Amersham Pharmacia Biotech), or pulled down with 4 μg of the indicated biotinylated CD3 peptide–coupled SV beads (Amersham Pharmacia Biotech). SDS-PAGE and immunoblotting were performed with the desired Abs, and visualization was done using a CCD camera (ImageQuant LAS 4000; GE Healthcare Life Sciences). Band intensity was assessed by the ImageJ software.

In situ proximity ligation assay

Jurkat or primary CD4+ T cells were grown on diagnostic microscopic slides (Thermo Scientific). Cells were left unstimulated, stimulated with the anti-TCR Ab C305, stimulated with C305 in the presence of 20 μM PP2 (after PP2 pretreatment), or treated with 1 mM PV at 37°C for 5 min. Cells were then fixed with paraformaldehyde, permeabilized with 0.5% saponin, and blocked with blocking solution. Cells were then coincubated with the goat anti-CD3ε (Ab M20 [Santa Cruz Biotechnology]) and a rabbit anti-Nck1 Ab (Cell Signaling Technology). A proximity ligation assay (PLA) between the CD3ε and Nck1 molecules was performed according to the manufacturer’s instructions with the Duolink kit (Olink Bioscience), resulting in red fluorescence signals. Cell nuclei were stained with DAPI. A confocal microscope (Nikon C2) was used for imaging and analysis. The number of the PLA signal dots was scored with the BlobFinder program (Uppsala University).

T cell activation assays

For the measurement of the kinetics of phosphorylation of AKT, MEK, and Erk, cells were stimulated with the anti-TCR Ab C305 (1:50) at 37°C for the indicated time points. SDS-PAGE and immunoblotting were performed with the Abs indicated, which were visualized using a CCD camera (ImageQuant LAS 4000; GE Healthcare Life Sciences). Quantification of the band intensities was assessed by the ImageJ software. To induce CD69 expression, 2 × 105 cells were starved overnight in a medium containing 1% serum at 37°C. Cells were incubated with the anti-TCR Ab C305 (1:50) at 37°C for 6 h and were then stained with an allophycocyanin-conjugated anti-CD69 Ab. The percentage of CD69+ cells was analyzed on a Beckman Coulter CyAn ADP flow cytometer. FlowJo 6.1 software was used for data analysis.

Ca2+ influx measurement

Five million cells were resuspended in 1 ml RPMI 1640 medium supplemented with 1% FCS and labeled in the dark with 0.1% pluronic acid, 2.6 μM Fluo-3 AM, and 5.5 μM Fura Red AM (Life Technologies) for 30 min at 37°C. The stained cells were washed and kept on ice in the dark until the measurement. For calcium influx, cells were diluted 1:10 with prewarmed medium and maintained at 37°C during the event collection on a Beckman Coulter CyAn ADP flow cytometer. Baseline fluorescence was monitored for 30 s, and then either medium or C305 (1:50) was added and the stimulation was recorded for 10 min. Data were analyzed with the FlowJo 6.1 software.

Statistical analysis

Data are represented as means ± SEM. All differences between experimental groups were analyzed with the Student t test. Significant differences were considered when the p values were <0.05.

Results

Active Lck is required for the interaction between Nck and the TCR upon TCR engagement

The binding of the TCR to beads coupled to the SH3.1(Nck) domain has been studied extensively (13, 16, 18, 19). However, the molecular requirements for the interaction between the TCR and endogenous Nck have not yet been fully explored. To determine whether the binding of Nck to the TCR is dependent on signal transduction, Jurkat cells were either pretreated with the Src tyrosine kinase inhibitor PP2 to prevent TCR phosphorylation by Lck and Fyn, or left untreated. Subsequently, cells were stimulated with the anti-idiotypic, anti-TCR Ab C305 or left unstimulated. In situ PLA is a technique that allows visualization (by a red fluorescent dot) of close proximity between endogenous proteins in fixed cells (31). Using PLA, we investigated the proximity of Nck with the cytoplasmic tail of CD3ε. Significantly more Nck–CD3ε PLA red dots were detected in stimulated compared with unstimulated cells (Fig. 1A), suggesting that endogenous Nck was recruited to the TCR upon TCR stimulation. In sharp contrast, PP2 treatment prevented the C305-induced proximity, indicating that Src kinase activity is necessary for the interaction of endogenous Nck to the triggered TCR. As a control, there was no PLA signal detected in the absence of either the anti-CD3ε or the anti-Nck1 primary Ab (Fig. 1A).

FIGURE 1.
  • Download figure
  • Open in new tab
  • Download powerpoint
FIGURE 1.

Lck activity is needed for Nck recruitment to the TCR. (A) Close proximity between the TCR and Nck was detected by in situ PLA. Jurkat cells were either pretreated with 20 μM PP2 or left untreated at 37°C for 30 min. Subsequently, cells were stimulated with the anti-TCR Ab (C305, 1:50) with or without PP2 at 37°C for 5 min or left unstimulated (uns). After fixation and permeabilization, PLA was performed using the primary Abs goat anti-CD3ε (M20) and rabbit anti-Nck1, as well as the corresponding secondary Abs. Negative controls, in which one of the primary Abs was omitted, were included (CD3ε Ab only, Nck1 Ab only). Nuclei were stained with DAPI. The corresponding quantification of the red PLA dots was scored from three independent experiments (data represent the mean ± SEM). (B) Jurkat cells were pretreated with PP2 and stimulated as in (A). Cell lysates were subjected to immunoprecipitation with the anti-CD3 Ab (OKT3). After SDS-PAGE, the Western blot was developed with anti-Nck1, anti–phospho-CD3ε (pCD3ε), and anti-ζ Abs. The corresponding lysates were developed with anti-ζ. Data are representative of five experiments. The intensity of the Nck1 and CD3ζ bands was quantified using ImageJ software and is presented as a ratio of Nck1 to CD3ζ normalized to the unstimulated cells (data represent the mean ± SEM). (C) Jurkat and J.Cam1.6 cells were either stimulated with C305 or left unstimulated, and immunoprecipitation with OKT3 was performed. SDS-PAGE, Western blotting, and quantification were done as in (B). Data are representative of five experiments. (D) Jurkat cells were either pretreated with PP2 or left untreated. Cells were then stimulated with C305 for the indicated times in the presence or absence of PP2. Immunoprecipitation, SDS-PAGE, and immunoblotting were done as in (B). Data are representative of at least two independent experiments. The intensity of the Nck1, pCD3ε, and ζ bands was quantified and is presented as a ratio of Nck1 or pCD3ε to ζ normalized to the unstimulated cells. (E) Primary human CD4+ T cells were purified from buffy coats. Cells were either pretreated with 20 μM PP2 or left untreated at 37°C for 30 min. Then cells were stimulated with 1 μg/ml OKT3 in the presence or absence of PP2 at 37°C for 5 min or left unstimulated (uns). PLA was performed as in (A). The corresponding quantification of the red PLA dots was scored and analyzed as in (A). Data are representative of three independent experiments (mean ± SEM). (F) Primary human CD4+ T cells were either left untreated or stimulated as in (E). Immunoprecipitation, SDS-PAGE, Western blotting, and analysis were done as in (B). Data are representative of three independent experiments. (A and E) Original magnification ×600. *p < 0.05, **p < 0.01, ***p < 0.001.

To test whether the induced Nck–TCR proximity was caused by Nck binding to the TCR, Jurkat cells were stimulated under the same conditions as in Fig. 1A and subjected to immunoprecipitation with anti-CD3 Abs. Consistent with the data from the PLA, Nck binding to the TCR was increased upon TCR triggering (Fig. 1B). Importantly, lower amounts of Nck were coimmunoprecipitated with the TCR from C305-stimulated and PP2-pretreated cells compared with C305-stimulated cells alone (Fig. 1B). As expected, PP2 was able to prevent tyrosine phosphorylation at CD3ε after TCR Ab–mediated engagement. When the coimmunoprecipitation experiment was performed using Lck-deficient Jurkat cells (J.Cam1.6), there was no increase of the TCR–Nck interaction upon C305 stimulation (Fig. 1C). Collectively, these data indicate that Lck activity is required for an efficient recruitment of Nck to the TCR.

Next, we performed a time course experiment of Nck coimmunopurification with the TCR using C305 as a TCR stimulus (Fig. 1D). At early time points (1 and 5 min) the increase in the association of Nck to the TCR correlated with the increase in CD3ε phosphorylation. However, at 10 min of stimulation, CD3ε phosphorylation still increased, whereas Nck recruitment decreased. This indicated that the recruitment of Nck might depend on another interaction besides the one using tyrosine phosphorylation of CD3ε. As before, stimulation of cells, in which tyrosine phosphorylation was inhibited by PP2, resulted in significantly weakened, but not absent, Nck recruitment. This might have been due to low levels of Lck activity or to binding of the SH3.1 domain of Nck to the PRS of CD3ε. Moreover, the requirement of Src kinase activity for Nck binding to the TCR was also observed in primary CD4+ T cells (Fig. 1E, 1F), because the Nck–TCR interaction was sharply declined in the presence of PP2.

Taken together, these data suggest that active Src tyrosine family kinases, such as Lck, are critical mediators for Nck recruitment. Therefore, CD3 phosphorylation seems to be required for an efficient Nck–TCR interaction upon TCR stimulation.

PV treatment does not induce the Nck–TCR interaction

Having found that TCR phosphorylation is needed for an efficient Nck1–TCR interaction, we tested whether massive phosphorylations, as induced by the phosphatase inhibitor PV, are sufficient to induce Nck binding to the TCR. To this end, Jurkat cells were either stimulated with PV alone or with the anti-TCR Ab C305 and PV simultaneously, or with C305 alone, or left unstimulated. As before, the close proximity between Nck and CD3ε was investigated using PLA. First, PV alone was not able to induce close proximity between Nck and the TCR and, second, PV even inhibited the C305-induced Nck–TCR proximity (Fig. 2A).

FIGURE 2.
  • Download figure
  • Open in new tab
  • Download powerpoint
FIGURE 2.

PV treatment does not induce Nck binding to the TCR. (A) Nck–TCR proximity was detected by in situ PLA. Jurkat cells were either stimulated with the anti-TCR Ab C305 with or without simultaneous treatment with PV, or with PV alone at 37°C for 5 min or left unstimulated. Experiment and analysis were done as in -. 1A. The corresponding quantification is shown as mean ± SEM of three independent experiments. (B) Jurkat cells were stimulated as in (A). Cellular lysates were subjected to immunoprecipitation with the anti-CD3 Ab OKT3. After SDS-PAGE the Western blot was developed with anti-Nck1, anti-pCD3ε, and anti-ζ Abs. The lysates were developed with anti-ζ. Data are representative of five experiments, and the statistical analysis was done as in Fig. 1B. (C) Primary human CD4+ T cells were purified from buffy coats and either stimulated with 1 μg/ml OKT3 with or without simultaneous treatment with PV, or with PV alone at 37°C for 5 min or left unstimulated. PLA was performed as in Fig. 1A. The corresponding quantification of the red PLA dots was scored and analyzed. Data are representative of three independent experiments (mean ± SEM). (D) Primary human CD4+ T cells were stimulated as in (C). Immunoprecipitation, SDS-PAGE, Western blotting, and analysis were done as in (B). Data are representative of three independent experiments. (A and C) Original magnification ×600. *p < 0.05, **p < 0.01, ***p < 0.001.

Likewise, Nck was not copurified with the TCR upon PV treatment and PV inhibited the C305-induced copurification of Nck with the TCR (Fig. 2B). Phosphorylation of CD3ε was strongly induced by PV, suggesting that massive CD3ε phosphorylation might interfere with the Nck–TCR interaction. Furthermore, the inhibitory effect of PV on the Nck–TCR interaction was confirmed using primary human CD4+ T cells (Fig. 2C, 2D), because the association of Nck to the TCR was dramatically decreased in the PV treatment.

Collectively, our data suggest that an intermediate level of tyrosine phosphorylation at CD3 is required for an efficient interaction between endogenous Nck and the triggered TCR.

Partial phosphorylation of CD3ε is required for efficient Nck binding

To test our hypothesis that only an intermediate pattern of tyrosine phosphorylation at CD3ε mediates Nck binding to the TCR, synthetic biotinylated peptides corresponding to the complete cytoplasmic tail of CD3ε were used (Fig. 3A): the nonphosphorylated CD3ε tail (ε), the CD3ε tail with the first cytoplasmic tyrosine phosphorylated (p39ε), with the second cytoplasmic tyrosine phosphorylated (p50ε), and the doubly phosphorylated CD3ε tail (ppε).

FIGURE 3.
  • Download figure
  • Open in new tab
  • Download powerpoint
FIGURE 3.

Only partially phopshorylated CD3ε can bind to Nck. (A) Schematic representation of the amino acid sequence of the different biotinylated CD3ε cytoplasmic tail synthetic peptides. Phosphorylations are indicated with a P. (B) The different synthetic CD3ε peptides shown in (A) were coupled to SV beads and incubated with the GST–SH2(Nck), GST–SH3.1(Nck), and GST–full-length Nck fusion proteins as indicated. Bead-bound proteins were separated by SDS-PAGE and the Western blot developed with an anti-Nck1 Ab as well as SV. Data are representative of three experiments. The intensity of the Nck and biotinylated peptide bands using full-length Nck was quantified using the ImageJ software and is presented as a ratio of Nck to peptide normalized to the value of the Nck/nonphosphorylated CD3ε peptide ratio (data represent the mean ± SEM). (C) Jurkat lysates were incubated with SV beads bound to different biotinylated CD3ε peptides. Bead-bound proteins were detected as in (B). The statistical analysis of Nck1 binding to the different CD3ε forms was done as in (B). (D) Jurkat lysates were incubated with SV beads bound to the indicated biotinylated CD3γ and CD3δ peptides. Beads-bound proteins were assessed as in (B). (E) Jurkat lysates were incubated with SV beads bound to the different biotinylated CD3ε peptides or to a mixture of unphosphorylated CD3ε and doubly phosphorylated CD3ε, CD3γ, or CDδ peptides as indicated. Bead-bound proteins and the lysates as controls were detected as in (B). *p < 0.05, **p < 0.01.

The different biotinylated CD3ε peptides were bound to SV-coupled beads, and their binding to the SH2(Nck), SH3.1(Nck), and full-length Nck as GST fusion proteins was tested in a pull-down assay (Fig. 3B). GST–SH2(Nck) was bound to all the phosphorylated CD3ε peptides (p39ε, p50ε, and ppε), but not to the nonphosphorylated peptide. In contrast, GST–SH3.1(Nck) was only bound to nonphosphorylated (ε) and the second tyrosine phosphorylated CD3ε peptide (p50ε) (Fig. 3B). These results are in line with our earlier findings that the SH3.1 domain binds to the PRS of CD3ε (13, 15), and that phosphorylation of the first tyrosine, which is located within the SH3.1 binding motif, inhibits SH3.1 binding (32–34). Interestingly, the GST–Nck full-length fusion protein was only bound to the p50ε peptide, suggesting that both an SH3.1–PRS (in the absence of Y39 phosphorylation) and an SH2–phosphotyrosine interaction were simultaneously needed for optimal Nck association (Fig. 3B).

Next, we repeated the CD3ε peptide pull-down assay using cellular lysates of Jurkat cells expressing endogenous Nck, instead of recombinantly expressed GST–Nck fusion proteins. Again, we saw that Nck bound strongly to the cytoplasmic sequence of CD3ε when the second tyrosine was phosphorylated alone (p50ε, Fig. 3C). Additionally, Nck bound weaker to the nonphosphorylated CD3ε (ε) peptide, indicating that the SH3.1(Nck) domain alone can mediate weak binding to CD3ε. Because the other CD3 subunits also contain phophorylatable tyrosines, we test whether the SH2(Nck) domain might be sufficient to bind full-length Nck to CD3γ and CD3δ. To this end, we repeated the pull-down assay using the nonphosphorylated, singly phosphorylated, and doubly phosphorylated peptides corresponding to the complete cytoplasmic tails of CD3γ and CD3δ (Fig. 3D). We found that Nck could not bind to CD3γ and CD3δ, even when they carried full tyrosine phosphorylation. Next, we examined whether the simultaneous SH3.1–PRS and SH2–phosphotyrosine interactions have to take place in cis, that is, the PRS and phosphotyrosine have to be present within one CD3ε molecule, or can also take place in trans, that is, the PRS and the phosphotyrosine can be located on different CD3ε molecules. To this end, Jurkat lysates were used in a pull-down experiment with a mixture of the unphosphorylated CD3ε (ε, only allowing SH3.1 binding) and the double phosphorylated CD3ε peptides being bound to the SV-coupled beads. As a control, the unphosphorylated CD3ε peptide was mixed with the double phosphorylated CD3γ or CD3δ peptides (ppγ or ppδ), which cannot mediate SH2 binding (Fig. 3E). We kept the total amount of peptide constant in each sample. Endogenous Nck protein from the cell lysates bound better to the mixture of ε and ppε than to ε alone or ppε alone (Fig. 3E). Importantly, there was a synergistic effect, in that more Nck bound to ε and ppε than the sum of Nck binding to ε alone and ppε alone. This synergistic effect was not observed when ε was mixed with ppγ or ppδ (Fig. 3D). Collectively, these data suggest that Nck is able to interact with juxtaposed CD3ε, with one being nonphosphorylated and one being phosphorylated.

Nck requires the SH3.1 and SH2 domains to bind to the TCR

Because we found that partial CD3ε phosphorylation was required for an efficient Nck binding, we hypothesized that Nck might use both its SH3.1 and SH2 domains to bind to the TCR. Hence, we simultaneously knocked down the expression of Nck1 and Nck2 in Jurkat cells using Nck1- and Nck2-specific shRNAs (shNck1/2 cells). Nck1/2 protein expression in shNck1/2 cells was reduced by ∼80% compared with control-shRNA–transfected cells (see Supplemental Fig. 1). shNck1/2 cells were reconstituted with Flag-tagged Nck constructs encoding either WT Nck1 (WT-Nck1), or Nck1 in which the first tryptophan in the WW motif at position 38 within the SH3.1 domain was mutated to lysine (SH3.1*-Nck1), or Nck1 in which arginine at position 308 within the SH2 domain was mutated to lysine (SH2*-Nck1) (Fig. 4A). The W38K point mutation in the SH3.1 domain disrupts the interaction of Nck with proline-rich proteins, whereas the R308K point mutation in the SH2 domain mutant impairs binding to phosphorylated tyrosine residues (2). The SH3.1*-Nck1 protein was expressed to a similar level as the WT-Nck1 protein, and the expression level of both proteins was >5-fold increased compared with the remaining level of endogenous Nck1 after the knockdown (Fig. 4B, data not shown). In contrast, the SH2*-Nck1 protein was only weakly expressed, and had a similar expression level as endogenous Nck after the knock down (Fig. 4B). All cells expressed similar amounts of TCR on their cell surface as shown by flow cytometry (Fig. 4C).

FIGURE 4.
  • Download figure
  • Open in new tab
  • Download powerpoint
FIGURE 4.

Nck needs the SH3.1 and SH2 domains to bind to the TCR. (A) Schematic illustration of Flag-tagged wild-type Nck (WT-Nck), SH3.1*-Nck (W38K) containing a non-functional SH3.1 domain, and SH2*-Nck (R308K) containing a nonfunctional SH2 domain. (B) Flag-tagged Nck1 expression from double Nck1/2 knock-down cells (shNck1/2) stably expressing WT-Nck1, SH3.1*-Nck1, or SH2*-Nck1. Lysates of the indicated cells were analyzed using immunoblotting with anti-Nck1 and anti-GAPDH Abs as a loading control. (C) Cells were stained with allophycocyanin-conjugated anti-CD3ε Ab UCHT1. Fluorescence intensities were measured by flow cytometry. (D) Lysates of shNck1/2 cells and WT-Nck1– and SH3.1*-Nck1–expressing cells were incubated with the indicated CD3ε peptides bound to SV-coupled beads. Bound proteins were detected as in Fig. 3. (E) Lysates of shNck1/2 and SH2*-Nck1–expressing cells were treated as in (E). (F) The statistics from three independent experiments as in (D) and (E) are presented as a ratio of Flag-tagged Nck to peptides normalized to the value of the Nck/nonphosphorylated CD3ε peptide ratio (data represent the mean ± SEM). (G) shNck1/2-, WT-Nck1–, and SH3.1*-Nck1–expressing cells were either left untreated or treated with anti-TCR (C305) Ab at 37°C for 5 min. The close proximity between Nck and TCR in these cells was detected using in situ PLA as done in Fig. 1A. The corresponding quantification of PLA signal dots was collected from three independent experiments and analyzed as in Fig. 1A (data represent the mean ± SEM). Original magnification ×600. (H) The WT-Nck1– and SH3.1*-Nck1–expressing cells were treated with indicated treatments or left untreated. Cell lysates were subjected to immunoprecipitation with anti-CD3 Ab (OKT3) following immunoblotting with anti-Nck1, anti-pCD3ε, and anti-ζ Abs. *p < 0.05, ***p < 0.001.

The cell lysates of shNck1/2 and WT-Nck1– and SH3.1*-Nck1–expressing shNck1/2 cells were subjected to the pull-down assay using different synthetic CD3ε peptides as in Fig. 3 (Fig. 4D). There was a substantial binding of the WT-Nck protein to the p50ε peptide and a weaker binding to the nonphosphorylated ε peptide, corroborating our findings of Fig. 3. In sharp contrast, the SH3.1*-Nck1 mutant did not bind strongly to any peptide, indicating that the SH3.1(Nck) domain is crucial for Nck binding to the TCR. Again, endogenous residual Nck bound best to the p50ε (Fig. 4D, 4F). Next, we repeated this experiment using the SH2*-Nck1–expressing cells (Fig. 4E, 4F). We found that, in contrast to the endogenous or WT-Nck, the SH2*-Nck1 protein could not bind strongly to the p50ε peptide, indicating that the SH2(Nck) domain is important for Nck binding to the TCR. Moreover, the binding to the unphosphorylated peptide was unchanged, indicating that the binding by the SH3.1 mutated was unaffected by the SH2 mutation. Altogether, these data indicate that Nck binding to the TCR crucially depends on the SH3.1 domain and it is stabilized or enhanced by the interaction of the SH2 domain with the phospho-Y50 of the CD3ε chain.

To further establish the loss of Nck recruitment to the TCR in cells that expressed the SH3.1*-Nck1 mutant, PLA was performed to determine the close proximity between SH3.1*-Nck and CD3ε molecules (Fig. 4G). There were a few PLA dots in shNck1/2 cells possibly due to residual endogenous Nck expression (Supplemental Fig. 1), which were used as a negative control. The number of PLA dots were significantly declined in SH3.1*-Nck1–expressing cells following TCR engagement as compared with stimulated WT-Nck1–expressing cells, corroborating our finding that the SH3.1(Nck) domain is critical for the Nck–TCR interaction. In stimulated SH3.1*-Nck1–expressing cells more PLA dots were detected than in stimulated shNck1/2 cells, suggesting that Nck was able to bind very weakly to the TCR through its SH2 domain (Fig. 4G). Consistent with the result from the PLA assay, the SH3.1*-Nck mutant was less coprecipitated with the TCR compared with the WT-Nck1 protein (Fig. 4H). Owing to the low expression level of SH2*-Nck, we did not perform these experiments with the SH2 domain mutant Nck. Taken together, these findings indicated that Nck binding to the stimulated TCR is mediated by the SH3.1(Nck) and SH2(Nck) domains.

Impairment of the Nck–CD3ε interaction impairs T cell activation

It has been suggested that the PRS of CD3ε and its interaction with Nck are required for optimal signaling induced by the TCR (13, 22, 35). To substantiate these findings, we analyzed the involvement of Nck’s interaction with the TCR for T cell activation, by using SH3.1*-Nck1–expressing shNck1/2 cells. The SH3.1*-Nck1 protein cannot bind to the TCR, but it retains other functions such as interactions using its SH3.2, SH3.3, and SH2 domains. WT-Nck1– and SH3.1*-Nck1–expressing shNck1/2 cells were stimulated with the anti-TCR Ab C305 in a time course experiment (Fig. 5A). The phosphorylation of CD3ε and recruitment of ZAP70 to the TCR were impaired in the shNck1/2 cells, but restored in the WT-Nck1 reconstituted cells, indicating that Nck is involved in these processes. A functional SH3.1(Nck) domain is important for these activities, because SH3.1*-Nck1 could not restore CD3ε phosphorylation or ZAP70 binding to the TCR. This suggests that Nck binding to the TCR is involved in CD3 phosphorylation.

FIGURE 5.
  • Download figure
  • Open in new tab
  • Download powerpoint
FIGURE 5.

Preventing the Nck1–CD3ε association impairs T cell activation. (A) shNck1/2 cells stably expressing WT-Nck1 or SH3.1*-Nck1 were stimulated with the anti-TCR Ab C305 for the indicated times. The CD3 immunoprecipitates were immunoblotted with the indicated Abs. The signal intensity of ZAP70 was quantified and presented as a ratio of ZAP70 to CD3ζ normalized to unstimulated shNck1/2 cells (data are representative for three experiments). (B) The indicated cells were treated as in (A) and cell lysates were separated by SDS-PAGE and the Western blot developed with anti–phospho-Akt (pAkt) and anti–phospho-Erk1/2 (pErk1/2) Abs. GAPDH serves as a loading control. The quantified signal intensities are presented as a ratio of the phospho-Erk1/2 and phospho-Akt to the corresponding GAPDH values normalized to the value of unstimulated shNck1/2 cells. Data are representative of three experiments (data represent the mean ± SEM). (C) WT-Nck1– and SH3.1*-Nck1–expressing shNck1/2 cells were stimulated with C305 for 6 h and stained with an anti-CD69 Ab following flow cytometry quantification. The percentage of CD69+ cells (left panel) and their mean fluorescence intensity (MFI, right panel) are displayed. Data are representative of four experiments and represent the mean ± SEM. (D) shNck1/2-, WT-Nck1–, and SH3.1*-Nck1–expressing cells were either left untreated (dotted line) or treated with anti-TCR Ab C305 (solid line) and Ca2+ influx was measured using flow cytometry. *p < 0.05, **p < 0.01, ***p < 0.001.

Next we assessed whether the reduced signaling at the TCR also impaired downstream events. We found that the TCR-induced phosphorylations of Akt and Erk1/2 were strongly reduced in cells expressing SH3.1*-Nck1 compared with the cells expressing WT-Nck1 (Fig. 5B). A very weak phosphorylation of Erk in the SH3.1*-Nck1–expressing cells as well as in the control shNck1/2 cells was observed, indicating that this activity might be due to the low expression levels of endogenous Nck proteins (Supplemental Fig. 1). Activation of Erk is required for CD69 expression in T cells (36, 37). In line with this, TCR-induced CD69 expression was absent in the SH3.1*-Nck1–expressing cells, whereas expression of CD69 was induced in the WT-Nck1–expressing cells (Fig. 5C).

Finally, we tested the influence of the SH3.1*-Nck1 mutant on calcium influx. The calcium response was strongly impaired in shNck1/2 cells, indicating that Nck is required for coupling the TCR to calcium influx. However, in the SH3.1*-Nck–expressing cells the same extent of calcium influx was detected as in WT-Nck1–expressing cells (Fig. 5D). This could suggest that strong Nck binding to the TCR is not required for TCR-induced calcium influx.

Taken together, these data indicate that strong Nck recruitment to the TCR is required for some (Akt, Erk1/2, CD69), but not for all (calcium), signaling events downstream of the TCR.

Discussion

The interaction of the recombinant SH3.1 domain of Nck with CD3ε has been studied in detail (13, 18–22). However, the molecular mechanism by which full-length Nck binds to the TCR has not been studied to date, although it has been speculated that recruitment of Nck to the TCR plays an important role for TCR triggering (13, 22, 35). In this study, we show that Nck uses both its SH3.1 and SH2 domains in a cooperative manner to bind to partially phosphorylated CD3ε.

Using the in situ PLA and coimmunopurifications, we found that Nck and the TCR associate with each other upon anti-TCR Ab stimulation. TCR triggering leads to the exposure of the CD3ε PRS to which the SH3.1(Nck) domain can bind (13), providing a molecular explanation for the ligand-induced recruitment of Nck to the TCR. However, we surprisingly found that Nck was not recruited to the TCR upon anti-TCR stimulation when tyrosine phosphorylation was inhibited using the kinase inhibitor PP2 or when Lck-deficient cells were used. Because the active TCR conformation is stabilized by ligand binding also in the presence of PP2 (14, 15, 18), our data suggest that TCR phosphorylation is needed for efficient Nck binding. Furthermore, we found that the Nck–TCR interaction increased within the first 5 min after TCR ligation, correlating with the increase of TCR phosphorylation. Moreover, phosphorylation of the second tyrosine (Y50) of the CD3ε is essential for Nck binding. These data again support the notion that TCR phosphorylation enhances Nck recruitment to the TCR. However, phosphorylation of tyrosine 39 (Y39) within the CD3ε PRS blocks binding of the SH3.1(Nck) domain to the CD3ε PRS (32).

The requirement of TCR phosphorylation for Nck recruitment to the TCR suggested that the SH2(Nck) domain might play a previously unappreciated role. Indeed, we found that the purified SH2(Nck) domain can bind to the cytoplasmic tail of CD3ε, but only when one or both of the CD3ε tyrosines were phosphorylated. Likewise, an intact SH2 domain in full-length Nck was required for a strong association of Nck to the TCR. Thus, the interaction between the SH2(Nck) domain and a phosphotyrosine of CD3ε is required for optimal Nck recruitment to the stimulated TCR.

Next, we induced massive phosphorylation of the TCR using the phosphatase inhibitor PV, which does not stabilize the active TCR conformation and thus does not result in the binding of the purified SH3.1(Nck) domain to the TCR (13, 18). Based on our finding that the SH2(Nck) domain can bind to phosphorylated CD3ε tyrosines, we expected to detect Nck binding to the TCR upon PV stimulation. However, PV did not induce Nck recruitment to the TCR. Furthermore, PV treatment prevented Nck association when combined with anti-TCR Ab stimulation. Thus, it seems that massive phosphorylation of the TCR abolishes Nck recruitment, being in line with the finding that phosphorylation of the CD3ε residue Y39 within the PRS abrogates SH3.1(Nck) binding (32). Indeed, NMR structures of the PRS binding to SH3.1(Nck) revealed that the nonphosphorylated Y39 is a crucial interaction point with the hydrophobic pocket of SH3.1(Nck) (33, 34). Indeed, the Nck–TCR interaction decreased at 10 min after TCR ligation, correlating with very strong CD3ε phosphorylation.

As discussed, the PV data suggested that the SH3.1(Nck) domain might interact with the nonphosphorylated and exposed CD3ε PRS. Indeed, we and others (13, 18) found that the purified SH3.1(Nck) domain can bind to the cytoplasmic tail of CD3ε, but only when Y39 was not phosphorylated. Likewise, an intact SH3.1 domain in full-length Nck was required for a stable association of Nck to the TCR. Thus, the interaction between the SH3.1(Nck) domain and the nonphosphorylated PRS is required for Nck recruitment to the stimulated TCR.

To resolve our seemingly paradoxical findings, we used synthetic CD3ε cytoplasmic tail peptides to mimic unphosphorylated and different patterns of phosphorylated CD3ε. Full-length Nck could only strongly associate to the peptide where the first tyrosine (Y39) was not phosphorylated, thus allowing the SH3.1(Nck) domain to bind, and when the second tyrosine (Y50) was phosphorylated, thus promoting SH2(Nck) domain binding. Because the interaction with one domain alone was not sufficient for optimal Nck binding, we conclude that both interactions have to occur in a collaborative manner (Fig. 6). Therefore, the exact pattern of phosphorylation of CD3ε determines Nck recruitment and could thus specify downstream signaling. It has been shown that agonistic stimulation leads to a different pattern of CD3ζ phosphorylation than antagonistic stimulation (38). However, whether this different pattern causes differentially downstream signaling is not yet resolved (39).

FIGURE 6.
  • Download figure
  • Open in new tab
  • Download powerpoint
FIGURE 6.

Illustration of Nck-binding to the ligand-/Ab-engaged TCR. Triggering of the TCR induces a conformational change of CD3ε (active TCR conformation), resulting in the exposure of the PRS (pink boxes). The exposed PRS can consequently interact with the SH3.1 domain of Nck (left), but only when the tyrosine contained in the PRS is not phosphorylated. This binding mode is suboptimal, thus promoting weak TCR signaling (left). If the second ITAM tyrosine of CD3ε is phosphorylated in the active TCR, Nck can bind with its SH3.1 and SH2 domains in a cooperative manner (right). This binding mode is strong, allowing optimal recruitment of Nck to the TCR promoting TCR signaling (right).

Although the endogenous Nck needs both the SH3.1 and the SH2 domains to optimally bind to the TCR, the purified SH3.1(Nck) domain binds with sufficient avidity to be used in a pull-down assay to purify the TCR in its active conformation (13, 15). According to the law of mass action, we suggest that the huge excess of SH3.1(Nck), as used in the pull-down assays, shifts the equilibrium toward TCR binding. The same might hold true for the SH2(Nck) domain under similar conditions. An alternative interpretation would be that Nck exists in an autoinhibited state, in which the SH3.1 domain cannot bind to the TCR and SH2 binding would free the SH3.1 domain. The isolated SH3.1 domain would always be available for binding to the CD3ε PRS.

Although the exact architecture of the TCR complex is unknown, some studies suggest that the CD3 heterodimers are clustered on one side of the TCR (40). Specifically, the two CD3ε chains seem to be juxtaposed to each other. We demonstrated that one Nck molecule can simultaneously interact with two CD3ε cytoplasmic tail peptides, one providing the SH3.1(Nck) interaction and the other one the SH2(Nck) interaction. However, phosphorylated CD3γ and CD3δ peptides cannot substitute for the phosphorylated CD3ε peptide, suggesting that the CD3ε subunit is the optimal binding site for Nck and that two Nck molecules can potentially simultaneously bind to the TCR.

Nck has been discussed to play a role at the TCR by binding to CD3ε (13, 22, 35) and at SLP76 by binding to phosphorylated SLP76 using its SH2(Nck) domain (10–12). Additionally, the SH3.3(Nck) domain binds to WASp, thus recruiting WASp to the SLP76 signalosome, promoting actin polymerization (11, 41, 42). Because Nck binds to WASp with its SH3.3(Nck) domain (42), it is possible that Nck serves as a physical bridge between the TCR and WASp (43), regulating cytoskeleton dynamics from the TCR.

In the present study, we used the shNck1/2 cells to express Nck1 molecules in which only the SH3.1 domain was mutated, and thus Nck was not able to optimally bind to the TCR. We found that after TCR engagement, CD3 was phosphorylated less in shNck1/2 and SH3.1*-Nck cells as compared with WT-Nck cells. This was associated with a decrease of ZAP70 recruitment to the TCR in the shNck1/2 and SH3.1*-Nck cells. Thus, Nckbinding to the TCR plays a crucial role by promoting CD3 phosphorylation. These findings are in agreement with a study using knock-in TCR transgenic mice bearing a CD3ε PRS mutation (22). Additionally, we showed that phosphorylation of Erk and expression of CD69 were strongly reduced in shNck1/2 and SH3.1*-Nck1 cells, as expected from reduced CD3 phosphorylation.

Furthermore, TCR-induced Ca2+ influx was defective in shNck1/2 cells but restored in the SH3.1*-Nck1–expressing cells. This could indicate that Nck is required for Ca2+ mobilization independent of its TCR binding capability. However, because CD3 phosphorylation is upstream of Ca2+ influx (44), we suggest that residual CD3 phosphorylation might be sufficient to promote Ca2+ signaling in our setting. This is in line with studies where mutation of the CD3ε PRS still allowed TCR-induced Ca2+ influx (45), but not with others where Ca2+ signaling was drastically reduced upon prevention of the CD3ε–Nck interaction (17, 46). This discrepancy might be related to the different mutations used. In conclusion, it seems that the level or the pattern of TCR phosphorylation needed for induction of Ca2+ influx is quantitatively or/and qualitatively different from the one needed to induce Erk or AKT phosphorylation.

We speculate that phosphorylation of the two CD3ε tyrosines is differentially regulated in time (Y50 is phosphorylated earlier than Y39), so that Nck is initially recruited to the TCR, promoting TCR activation, but dissociates after longer stimulation times to qualitatively and/or quantitatively alter TCR signaling. Thus, CD3 tyrosines are not redundant and might have specific roles. The implications need to be explored.

In summary, in the present study we identify the molecular requirements for Nck binding to the TCR, highlighting that the exact pattern of CD3 phosphorylation (in this case a partial CD3ε phosphorylation) might be critical for TCR functioning and T cell activation (Fig. 6). Thus, Nck is an important adaptor protein that participates in the initiation of TCR signaling at the TCR.

Disclosures

The authors have no financial conflicts of interest.

Acknowledgments

We thank Sang Sri-ampai, Kwansuda Supalap, Pimporn Udompol, and Sirirat Bunarsa (Biomedical Research Unit, Faculty of Medicine, Naresuan University) for technical assistance. We thank Prof. Dr. Bruce J. Mayer (Connecticut University Health Center, Farmington, CT) for providing human Nck1 cDNA and the BIOSS toolbox for providing us with reagents. Thanks go to Dr. Sarawut Kumphune and Dr. Rerngwit Boonyom, Department of Medical Technology, Faculty of Allied Health Science, as well as Dr. Pannika Ritvirool, Department of Microbiology and Parasitology, Faculty of Medical Science, Naresuan University, for technical suggestions.

Footnotes

  • P.P. and P.W. were supported by the Royal Golden Jubilee Ph.D. Programme of the Thailand Research Fund. S.P. has received support from Naresuan University Grant R2558B105 and by Thailand Research Fund Grant RSA5880009. This work was also supported by German Research Foundation Grant EXC294 (BIOSS) (to O.S.Y., S.M., and W.W.S.), European Union Grant FP7/2007-2013 (SYBILLA) (to W.W.S. and E.P.D.), and by an Innovationfonds Forschung 2012 grant (to F.A.H. and S.M.).

  • The online version of this article contains supplemental material.

  • Abbreviations used in this article:

    Nck
    noncatalytic region of tyrosine kinase
    PLA
    proximity ligation assay
    PRS
    proline-rich sequence
    PV
    pervanadate
    sh
    short hairpin
    SV
    streptavidin
    WT
    wild-type.

  • Received April 27, 2015.
  • Accepted October 23, 2015.
  • Copyright © 2015 by The American Association of Immunologists, Inc.

References

  1. ↵
    1. Buday L.,
    2. L. Wunderlich,
    3. P. Tamás
    . 2002. The Nck family of adapter proteins: regulators of actin cytoskeleton. Cell. Signal. 14: 723–731.
    OpenUrlCrossRefPubMed
  2. ↵
    1. Lettau M.,
    2. J. Pieper,
    3. O. Janssen
    . 2009. Nck adapter proteins: functional versatility in T cells. Cell Commun. Signal. 7: 1.
    OpenUrlCrossRefPubMed
  3. ↵
    1. Burkhardt J. K.,
    2. E. Carrizosa,
    3. M. H. Shaffer
    . 2008. The actin cytoskeleton in T cell activation. Annu. Rev. Immunol. 26: 233–259.
    OpenUrlCrossRefPubMed
  4. ↵
    1. Jacobs H.
    1997. Pre-TCR/CD3 and TCR/CD3 complexes: decamers with differential signalling properties? Immunol. Today 18: 565–569.
    OpenUrlPubMed
  5. ↵
    1. Alarcón B.,
    2. D. Gil,
    3. P. Delgado,
    4. W. W. Schamel
    . 2003. Initiation of TCR signaling: regulation within CD3 dimers. Immunol. Rev. 191: 38–46.
    OpenUrlCrossRefPubMed
  6. ↵
    1. Love P. E.,
    2. S. M. Hayes
    . 2010. ITAM-mediated signaling by the T-cell antigen receptor. Cold Spring Harb. Perspect. Biol. 2: a002485.
    OpenUrlAbstract/FREE Full Text
  7. ↵
    1. Reth M.
    1989. Antigen receptor tail clue. Nature 338: 383–384.
    OpenUrlCrossRefPubMed
  8. ↵
    1. Lin J.,
    2. A. Weiss
    . 2001. T cell receptor signalling. J. Cell Sci. 114: 243–244.
    OpenUrlFREE Full Text
  9. ↵
    1. Guy C. S.,
    2. D. A. Vignali
    . 2009. Organization of proximal signal initiation at the TCR:CD3 complex. Immunol. Rev. 232: 7–21.
    OpenUrlCrossRefPubMed
  10. ↵
    1. Wunderlich L.,
    2. A. Faragó,
    3. J. Downward,
    4. L. Buday
    . 1999. Association of Nck with tyrosine-phosphorylated SLP-76 in activated T lymphocytes. Eur. J. Immunol. 29: 1068–1075.
    OpenUrlCrossRefPubMed
  11. ↵
    1. Barda-Saad M.,
    2. A. Braiman,
    3. R. Titerence,
    4. S. C. Bunnell,
    5. V. A. Barr,
    6. L. E. Samelson
    . 2005. Dynamic molecular interactions linking the T cell antigen receptor to the actin cytoskeleton. Nat. Immunol. 6: 80–89.
    OpenUrlCrossRefPubMed
  12. ↵
    1. Jordan M. S.,
    2. G. A. Koretzky
    . 2010. Coordination of receptor signaling in multiple hematopoietic cell lineages by the adaptor protein SLP-76. Cold Spring Harb. Perspect. Biol. 2: a002501.
    OpenUrlAbstract/FREE Full Text
  13. ↵
    1. Gil D.,
    2. W. W. Schamel,
    3. M. Montoya,
    4. F. Sánchez-Madrid,
    5. B. Alarcón
    . 2002. Recruitment of Nck by CD3ε reveals a ligand-induced conformational change essential for T cell receptor signaling and synapse formation. Cell 109: 901–912.
    OpenUrlCrossRefPubMed
  14. ↵
    1. Minguet S.,
    2. W. W. Schamel
    . 2008. Permissive geometry model. Adv. Exp. Med. Biol. 640: 113–120.
    OpenUrlCrossRefPubMed
  15. ↵
    1. Minguet S.,
    2. M. Swamy,
    3. B. Alarcón,
    4. I. F. Luescher,
    5. W. W. Schamel
    . 2007. Full activation of the T cell receptor requires both clustering and conformational changes at CD3. Immunity 26: 43–54.
    OpenUrlCrossRefPubMed
  16. ↵
    1. Martínez-Martín N.,
    2. R. M. Risueño,
    3. A. Morreale,
    4. I. Zaldívar,
    5. E. Fernández-Arenas,
    6. F. Herranz,
    7. A. R. Ortiz,
    8. B. Alarcón
    . 2009. Cooperativity between T cell receptor complexes revealed by conformational mutants of CD3ε. Sci. Signal. 2: ra43.
    OpenUrlAbstract/FREE Full Text
  17. ↵
    1. Blanco R.,
    2. A. Borroto,
    3. W. Schamel,
    4. P. Pereira,
    5. B. Alarcon
    . 2014. Conformational changes in the T cell receptor differentially determine T cell subset development in mice. Sci. Signal. 7: ra115.
    OpenUrlAbstract/FREE Full Text
  18. ↵
    1. Gil D.,
    2. A. G. Schrum,
    3. B. Alarcón,
    4. E. Palmer
    . 2005. T cell receptor engagement by peptide-MHC ligands induces a conformational change in the CD3 complex of thymocytes. J. Exp. Med. 201: 517–522.
    OpenUrlAbstract/FREE Full Text
  19. ↵
    1. Risueño R. M.,
    2. D. Gil,
    3. E. Fernández,
    4. F. Sánchez-Madrid,
    5. B. Alarcón
    . 2005. Ligand-induced conformational change in the T-cell receptor associated with productive immune synapses. Blood 106: 601–608.
    OpenUrlAbstract/FREE Full Text
    1. Risueño R. M.,
    2. H. M. van Santen,
    3. B. Alarcón
    . 2006. A conformational change senses the strength of T cell receptor-ligand interaction during thymic selection. Proc. Natl. Acad. Sci. USA 103: 9625–9630.
    OpenUrlAbstract/FREE Full Text
    1. de la Cruz J.,
    2. T. Kruger,
    3. C. A. Parks,
    4. R. L. Silge,
    5. N. S. van Oers,
    6. I. F. Luescher,
    7. A. G. Schrum,
    8. D. Gil
    . 2011. Basal and antigen-induced exposure of the proline-rich sequence in CD3ε. J. Immunol. 186: 2282–2290.
    OpenUrlAbstract/FREE Full Text
  20. ↵
    1. Borroto A.,
    2. I. Arellano,
    3. E. P. Dopfer,
    4. M. Prouza,
    5. M. Suchànek,
    6. M. Fuentes,
    7. A. Orfao,
    8. W. W. Schamel,
    9. B. Alarcón
    . 2013. Nck recruitment to the TCR required for ZAP70 activation during thymic development. J. Immunol. 190: 1103–1112.
    OpenUrlAbstract/FREE Full Text
  21. ↵
    1. Ngoenkam J.,
    2. P. Paensuwan,
    3. K. Preechanukul,
    4. B. Khamsri,
    5. I. Yiemwattana,
    6. E. Beck-García,
    7. S. Minguet,
    8. W. W. Schamel,
    9. S. Pongcharoen
    . 2014. Non-overlapping functions of Nck1 and Nck2 adaptor proteins in T cell activation. Cell Commun. Signal. 12: 21.
    OpenUrlCrossRefPubMed
  22. ↵
    1. San José E.,
    2. A. G. Sahuquillo,
    3. R. Bragado,
    4. B. Alarcón
    . 1998. Assembly of the TCR/CD3 complex: CD3ε/δ and CD3ε/γ dimers associate indistinctly with both TCR α and TCR β chains. Evidence for a double TCR heterodimer model. Eur. J. Immunol. 28: 12–21.
    OpenUrlCrossRefPubMed
  23. ↵
    1. Dopfer E. P.,
    2. B. Schöpf,
    3. C. Louis-Dit-Sully,
    4. E. Dengler,
    5. K. Höhne,
    6. A. Klescová,
    7. M. Prouza,
    8. M. Suchanek,
    9. M. Reth,
    10. W. W. Schamel
    . 2010. Analysis of novel phospho-ITAM specific antibodies in a S2 reconstitution system for TCR-CD3 signalling. Immunol. Lett. 130: 43–50.
    OpenUrlCrossRefPubMed
  24. ↵
    1. Paensuwan P.,
    2. J. Ngoenkam,
    3. D. Sanguansermsri,
    4. B. Khamsri,
    5. I. Yiemwattana,
    6. A. Wangteeraprasert,
    7. S. Pongcharoen
    . 2014. RNAi down-regulation of Nck1 adaptor protein in Jurkat T cells. Sci. Asia 40: 340–347.
    OpenUrlCrossRef
  25. ↵
    1. Lu W.,
    2. S. Katz,
    3. R. Gupta,
    4. B. J. Mayer
    . 1997. Activation of Pak by membrane localization mediated by an SH3 domain from the adaptor protein Nck. Curr. Biol. 7: 85–94.
    OpenUrlCrossRefPubMed
  26. ↵
    1. Chen M.,
    2. H. She,
    3. A. Kim,
    4. D. T. Woodley,
    5. W. Li
    . 2000. Nckβ adapter regulates actin polymerization in NIH 3T3 fibroblasts in response to platelet-derived growth factor bb. Mol. Cell. Biol. 20: 7867–7880.
    OpenUrlAbstract/FREE Full Text
  27. ↵
    1. Tanaka M.,
    2. R. Gupta,
    3. B. J. Mayer
    . 1995. Differential inhibition of signaling pathways by dominant-negative SH2/SH3 adapter proteins. Mol. Cell. Biol. 15: 6829–6837.
    OpenUrlAbstract/FREE Full Text
  28. ↵
    1. Schamel W. W.,
    2. I. Arechaga,
    3. R. M. Risueño,
    4. H. M. van Santen,
    5. P. Cabezas,
    6. C. Risco,
    7. J. M. Valpuesta,
    8. B. Alarcón
    . 2005. Coexistence of multivalent and monovalent TCRs explains high sensitivity and wide range of response. J. Exp. Med. 202: 493–503.
    OpenUrlAbstract/FREE Full Text
  29. ↵
    1. Söderberg O.,
    2. M. Gullberg,
    3. M. Jarvius,
    4. K. Ridderstråle,
    5. K. J. Leuchowius,
    6. J. Jarvius,
    7. K. Wester,
    8. P. Hydbring,
    9. F. Bahram,
    10. L. G. Larsson,
    11. U. Landegren
    . 2006. Direct observation of individual endogenous protein complexes in situ by proximity ligation. Nat. Methods 3: 995–1000.
    OpenUrlCrossRefPubMed
  30. ↵
    1. Kesti T.,
    2. A. Ruppelt,
    3. J. H. Wang,
    4. M. Liss,
    5. R. Wagner,
    6. K. Taskén,
    7. K. Saksela
    . 2007. Reciprocal regulation of SH3 and SH2 domain binding via tyrosine phosphorylation of a common site in CD3ε. J. Immunol. 179: 878–885.
    OpenUrlAbstract/FREE Full Text
  31. ↵
    1. Takeuchi K.,
    2. H. Yang,
    3. E. Ng,
    4. S. Y. Park,
    5. Z. Y. Sun,
    6. E. L. Reinherz,
    7. G. Wagner
    . 2008. Structural and functional evidence that Nck interaction with CD3ε regulates T-cell receptor activity. J. Mol. Biol. 380: 704–716.
    OpenUrlCrossRefPubMed
  32. ↵
    1. Santiveri C. M.,
    2. A. Borroto,
    3. L. Simón,
    4. M. Rico,
    5. B. Alarcón,
    6. M. A. Jiménez
    . 2009. Interaction between the N-terminal SH3 domain of Nck-α and CD3-ε-derived peptides: non-canonical and canonical recognition motifs. Biochim. Biophys. Acta 1794: 110–117.
    OpenUrlCrossRefPubMed
  33. ↵
    1. Borroto A.,
    2. I. Arellano,
    3. R. Blanco,
    4. M. Fuentes,
    5. A. Orfao,
    6. E. P. Dopfer,
    7. M. Prouza,
    8. M. Suchànek,
    9. W. W. Schamel,
    10. B. Alarcón
    . 2014. Relevance of Nck-CD3ε interaction for T cell activation in vivo. J. Immunol. 192: 2042–2053.
    OpenUrlAbstract/FREE Full Text
  34. ↵
    1. D’Ambrosio D.,
    2. D. A. Cantrell,
    3. L. Frati,
    4. A. Santoni,
    5. R. Testi
    . 1994. Involvement of p21ras activation in T cell CD69 expression. Eur. J. Immunol. 24: 616–620.
    OpenUrlCrossRefPubMed
  35. ↵
    1. Villalba M.,
    2. J. Hernandez,
    3. M. Deckert,
    4. Y. Tanaka,
    5. A. Altman
    . 2000. Vav modulation of the Ras/MEK/ERK signaling pathway plays a role in NFAT activation and CD69 up-regulation. Eur. J. Immunol. 30: 1587–1596.
    OpenUrlCrossRefPubMed
  36. ↵
    1. Kersh E. N.,
    2. A. S. Shaw,
    3. P. M. Allen
    . 1998. Fidelity of T cell activation through multistep T cell receptor ζ phosphorylation. Science 281: 572–575.
    OpenUrlAbstract/FREE Full Text
  37. ↵
    1. Pitcher L. A.,
    2. P. S. Ohashi,
    3. N. S. van Oers
    . 2003. T cell antagonism is functionally uncoupled from the 21- and 23-kDa tyrosine-phosphorylated TCR ζ subunits. J. Immunol. 171: 845–852.
    OpenUrlAbstract/FREE Full Text
  38. ↵
    1. Kuhns M. S.,
    2. A. T. Girvin,
    3. L. O. Klein,
    4. R. Chen,
    5. K. D. Jensen,
    6. E. W. Newell,
    7. J. B. Huppa,
    8. B. F. Lillemeier,
    9. M. Huse,
    10. Y. H. Chien,
    11. et al
    . 2010. Evidence for a functional sidedness to the αβTCR. Proc. Natl. Acad. Sci. USA 107: 5094–5099.
    OpenUrlAbstract/FREE Full Text
  39. ↵
    1. Fuller C. L.,
    2. V. L. Braciale,
    3. L. E. Samelson
    . 2003. All roads lead to actin: the intimate relationship between TCR signaling and the cytoskeleton. Immunol. Rev. 191: 220–236.
    OpenUrlCrossRefPubMed
  40. ↵
    1. Zeng R.,
    2. J. L. Cannon,
    3. R. T. Abraham,
    4. M. Way,
    5. D. D. Billadeau,
    6. J. Bubeck-Wardenberg,
    7. J. K. Burkhardt
    . 2003. SLP-76 coordinates Nck-dependent Wiskott-Aldrich syndrome protein recruitment with Vav-1/Cdc42-dependent Wiskott-Aldrich syndrome protein activation at the T cell-APC contact site. J. Immunol. 171: 1360–1368.
    OpenUrlAbstract/FREE Full Text
  41. ↵
    1. Paensuwan P.,
    2. J. Ngoenkam,
    3. B. Khamsri,
    4. K. Preechanukul,
    5. D. Sanguansermsri,
    6. S. Pongcharoen
    . 2015. Evidence for inducible recruitment of Wiskott-Aldrich syndrome protein to T cell receptor-CD3 complex in Jurkat T cells. Asian Pac. J. Allergy Immunol. 33: 189–195.
    OpenUrlPubMed
  42. ↵
    1. Feske S.
    2007. Calcium signalling in lymphocyte activation and disease. Nat. Rev. Immunol. 7: 690–702.
    OpenUrlCrossRefPubMed
  43. ↵
    1. Mingueneau M.,
    2. A. Sansoni,
    3. C. Grégoire,
    4. R. Roncagalli,
    5. E. Aguado,
    6. A. Weiss,
    7. M. Malissen,
    8. B. Malissen
    . 2008. The proline-rich sequence of CD3ε controls T cell antigen receptor expression on and signaling potency in preselection CD4+CD8+ thymocytes. Nat. Immunol. 9: 522–532.
    OpenUrlCrossRefPubMed
  44. ↵
    1. Tailor P.,
    2. S. Tsai,
    3. A. Shameli,
    4. P. Serra,
    5. J. Wang,
    6. S. Robbins,
    7. M. Nagata,
    8. A. L. Szymczak-Workman,
    9. D. A. Vignali,
    10. P. Santamaria
    . 2008. The proline-rich sequence of CD3ε as an amplifier of low-avidity TCR signaling. J. Immunol. 181: 243–255.
    OpenUrlAbstract/FREE Full Text
View Abstract
PreviousNext
Back to top

In this issue

The Journal of Immunology: 196 (1)
The Journal of Immunology
Vol. 196, Issue 1
1 Jan 2016
  • Table of Contents
  • Table of Contents (PDF)
  • About the Cover
  • Advertising (PDF)
  • Back Matter (PDF)
  • Editorial Board (PDF)
  • Front Matter (PDF)
Print
Download PDF
Article Alerts
Sign In to Email Alerts with your Email Address
Email Article

Thank you for your interest in spreading the word about The Journal of Immunology.

NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.

Enter multiple addresses on separate lines or separate them with commas.
Nck Binds to the T Cell Antigen Receptor Using Its SH3.1 and SH2 Domains in a Cooperative Manner, Promoting TCR Functioning
(Your Name) has forwarded a page to you from The Journal of Immunology
(Your Name) thought you would like to see this page from the The Journal of Immunology web site.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.
Citation Tools
Nck Binds to the T Cell Antigen Receptor Using Its SH3.1 and SH2 Domains in a Cooperative Manner, Promoting TCR Functioning
Pussadee Paensuwan, Frederike A. Hartl, O. Sascha Yousefi, Jatuporn Ngoenkam, Piyamaporn Wipa, Esmeralda Beck-Garcia, Elaine P. Dopfer, Boonruang Khamsri, Donruedee Sanguansermsri, Susana Minguet, Wolfgang W. Schamel, Sutatip Pongcharoen
The Journal of Immunology January 1, 2016, 196 (1) 448-458; DOI: 10.4049/jimmunol.1500958

Citation Manager Formats

  • BibTeX
  • Bookends
  • EasyBib
  • EndNote (tagged)
  • EndNote 8 (xml)
  • Medlars
  • Mendeley
  • Papers
  • RefWorks Tagged
  • Ref Manager
  • RIS
  • Zotero
Share
Nck Binds to the T Cell Antigen Receptor Using Its SH3.1 and SH2 Domains in a Cooperative Manner, Promoting TCR Functioning
Pussadee Paensuwan, Frederike A. Hartl, O. Sascha Yousefi, Jatuporn Ngoenkam, Piyamaporn Wipa, Esmeralda Beck-Garcia, Elaine P. Dopfer, Boonruang Khamsri, Donruedee Sanguansermsri, Susana Minguet, Wolfgang W. Schamel, Sutatip Pongcharoen
The Journal of Immunology January 1, 2016, 196 (1) 448-458; DOI: 10.4049/jimmunol.1500958
del.icio.us logo Digg logo Reddit logo Twitter logo Facebook logo Google logo Mendeley logo
  • Tweet Widget
  • Facebook Like

Jump to section

  • Article
    • Abstract
    • Introduction
    • Materials and Methods
    • Results
    • Discussion
    • Disclosures
    • Acknowledgments
    • Footnotes
    • References
  • Figures & Data
  • Info & Metrics
  • PDF + SI
  • PDF

Related Articles

Cited By...

More in this TOC Section

  • Poor-Quality Vβ Recombination Signal Sequences and the DNA Damage Response ATM Kinase Collaborate to Establish TCRβ Gene Repertoire and Allelic Exclusion
  • Multifaceted Activities of Seven Nanobodies against Complement C4b
  • Promoter Proximity Defines Mutation Window for VH and VΚ Genes Rearranged to Different J Genes
Show more MOLECULAR AND STRUCTURAL IMMUNOLOGY

Similar Articles

Navigate

  • Home
  • Current Issue
  • Next in The JI
  • Archive
  • Brief Reviews
  • Pillars of Immunology
  • Translating Immunology

For Authors

  • Submit a Manuscript
  • Instructions for Authors
  • About the Journal
  • Journal Policies
  • Editors

General Information

  • Advertisers
  • Subscribers
  • Rights and Permissions
  • Accessibility Statement
  • FAR 889
  • Privacy Policy
  • Disclaimer

Journal Services

  • Email Alerts
  • RSS Feeds
  • ImmunoCasts
  • Twitter

Copyright © 2022 by The American Association of Immunologists, Inc.

Print ISSN 0022-1767        Online ISSN 1550-6606