Human Serum Amyloid P Functions as a Negative Regulator of the Innate and Adaptive Immune Responses to DNA Vaccines

Yue Wang, Yingjun Guo, Xiaohui Wang, Jinfeng Huang, Jingli Shang and Shuhan Sun
J Immunol March 1, 2011, 186 (5) 2860-2870; DOI: https://doi.org/10.4049/jimmunol.1003641

Abstract

The utility of DNA vaccines has been limited by their failure to elicit sufficiently potent immune responses in many human applications, whereas DNA vaccinations in mice have been very successful. However, the underlying mechanisms remain unknown. We hypothesize that serum amyloid P component (SAP), which has a species-specific, DNA-binding ability, contributes to the differences between human and mice and then limits DNA vaccine’s efficacy in vivo. In our study, DNA vaccine-induced adaptive immune responses were also significantly decreased in the human SAP (hSAP) transgenic mice. Using human promonocytic cell line THP-1–derived macrophages as a cell model, we found that cells incubated with a hSAP–DNA complex showed significant defects in innate immune activations, whereas mouse SAP had similar, albeit very weak, activities. hSAP also significantly inhibited the functions of two identified DNA sentinels, high-mobility group B protein 1 and antimicrobial peptide LL37, and redirected DNA update to FcRs leading to endocytosis and endosomal degradation. We also found that a chemical SAP inhibitor strongly recovered the suppressed innate immune responses to DNA in the presence of human serum and enhanced the immunogenicity of DNA vaccines in vivo. Our data indicated that SAP is a key negative regulator for innate immune responses to DNA and may be partly responsible for the insufficient immune responses after DNA vaccinations in humans. SAP suppression may be a novel strategy for improving efficacy of human DNA vaccines and requires further clinical investigations.

Over the last decade, the demonstration that plasmid DNA vaccines can induce both humoral and cellular immune responses to a variety of cancer and infectious diseases has engendered considerable excitement in the medical society (1–3). The speed of construction of DNA vaccines presents a real advantage for both prophylaxis and therapy of new pathogens, including emerging infectious agents, such as severe acute respiratory syndrome virus and emerging strains of influenza (2). Therapeutic vaccination is also available using DNA vaccines because they can offer a unique opportunity to guide defined Ags, accompanied by specific activator molecules, through a patient’s compromised immune system (4). In this regard, DNA vaccine holds enormous promise of vaccinologists and has entered into a variety of human clinical trials in the last decade.

However, despite its great success in mice-based investigations, the use of DNA vaccines has been greatly limited by their failure to elicit sufficiently potent immune responses in large animals and especially in human clinical trials (3, 4), and the underlying mechanisms that contribute to the differences in species-specific efficacy remain unknown. Accordingly, attempts have been made in recent years to find adjuvants that will enhance the immunogenicity of plasmid DNA vaccines (5). In our opinion, the identification of species-specific agents in the mechanism of DNA vaccines may be an urgent need to develop novel chemical adjuvant and is the main purpose of this study.

A fundamental initial and determined step in DNA vaccination is that the DNA vaccine needs to be transfected into various types of cells in situ and then result in subsequent Ag expression and innate immune activation in vivo (1). It is well-known that there are abundant physiological circular DNA-binding proteins in the extracellular environment. Certainly these proteins first meet the administered plasmids, and we therefore hypothesize that some of them may contribute to the insufficient efficacy of DNA vaccine. Factually, recent studies have indicated that several extracellular DNA-binding proteins, such as high-mobility group B protein (HMGB) (6), antimicrobial peptide LL37 (also known as CAMP) (7), and heparan sulfate proteoglycan (8), may play a key role in DNA uptake under physiological conditions (6, 7).

Another important mechanism of DNA vaccines is that DNA potently activates the innate immune responses through various DNA sensors such as endosomal TLR9 (9) and cytosolic DNA-sensing receptors (10–15), and the innate activation is crucial to the immunogenicity of DNA vaccines (11). Interestingly, it was also recently shown that the extracellular DNA-binding proteins can act as nucleic acid sentinels and convert extracellular DNA into a potent trigger of innate immune activation (16–19), which subsequently breaks innate tolerance to DNA and may drive many autoimmune diseases (20). For example, HMGBs function as universal sentinels for all immunogenic nucleic acids (6, 16, 21). LL37 binds and delivers DNA into plasmacytoid dendritic cells to trigger TLR9 (7). All those recent advances about extracellular DNA-binding proteins provide novel directions to study the underlying mechanism of DNA vaccine, which gives us a new hope to develop optimal vaccines for clinical applications.

However, it remains unknown whether an extracellular DNA-binding protein exists that negatively regulates the DNA uptake and innate immune recognition. In this study, we hypothesize that certain extracellular molecules may facilitate the clearance of extracellular DNA and form barriers that prevent the immune responses to DNA vaccines. To identify the potential barrier molecules, we previously scanned and identified the DNA-binding proteins found in human and mouse serum. Among those identified proteins, human serum amyloid P component (hSAP) was the most intriguing protein. First, SAP is well-known as the major genomic DNA-binding protein in human plasma (22), but mouse SAP (mSAP) has a much weaker ability to bind DNA (23). Furthermore, SAP is a member of the short pentraxin family, which is constitutively present in human serum at 30 to 50 μg/ml and is a normal component of basement membranes (24, 25). At the same time, many reports have also shown that SAP can bind apoptotic cells and zymosan in a calcium-dependent manner and enhance their phagocytosis by macrophages (25, 26). In this regard, we believed that hSAP is a candidate DNA vaccine “scavenger.” However, the role of hSAP in innate immune recognition of DNA and the underlying molecular mechanisms remain undefined and require further investigations.

Because the interventions cannot be tested in humans for ethical reasons, in this study, we used a humanized mouse model, a transgenic (Tg) mouse strain physiologically expressing hSAP, to confirm our hypothesis. We also investigated the molecular and cellular mechanisms of hSAP-mediated immune suppression in vitro and in vivo. Based on our data, we demonstrated a fundamental and important role of a circulating pentraxin in the negative regulation of immune recognition of DNA vaccine. We suggest that SAP may be partly responsible for insufficient immune responses after DNA vaccination in humans and further suggest its potential implications for improving DNA vaccine efficacy.

Materials and Methods

Mouse and cells

hSAP Tg mice (Tg[Alb, SAP]; C57BL/6, H-2b) were generated by Model Animal Research Center of Nanjing University (China), which contains the entire hSAP open reading frame under transcriptional control of the mouse albumin promoter and produces high-level hSAP in serum. C57BL/6 mice were obtained from the Shanghai Laboratory Animal (China). The HEK293 cells were cultured in DMEM (Invitrogen, Carlsbad, CA) supplemented with 10% FBS (Invitrogen). THP-1 cells were maintained in RPMI 1640 medium (Invitrogen) supplemented with 10% FBS. PMA (10 μg/ml; Sigma-Aldrich, St. Louis, MO) was added into the THP-1 medium to induce macrophage differentiation, and the cells were cultured for 3 d with daily medium replacement.

Reagents

hSAP and mSAP were purified, stored, and dialyzed as previously described (27, 28). They were stored frozen at −70°C in solution in 10 mM Tris, 140 mM NaCl, 10 mM EDTA, 0.1% NaN3, pH 8.0 (Tris-sodium-EDTA buffer), and were dialyzed into 10 mM Tris, 140mM NaCl, pH 8.0 (Tris-sodium buffer) before use. The peptide LL37 ([LL-37, 37 aa]) was synthesized and biotinylated by Sangon Biotech (Shanghai, China). A SAP inhibitor CHPHC (R-1-[6-[R-2-carboxy-pyrrolidin-1-yl]-6-oxo-hexanoyl] pyrrolidine-2-carboxylic acid) was synthesized according to previous reports (29). Human C-reactive protein (CRP) was obtained from Sigma-Aldrich, and Texas Red-conjugated human transferrin was from Rockland (Gilbertsville, PA). A monospecific Ab for hSAP (Abcam, Cambridge, MA) and a goat polyclonal Ab both for hSAP and mSAP (Santa Cruz Biotechnology, Santa Cruz, CA) were used. Other Abs for early endosome Ag 1, CD107a (BD Pharmingen, San Diego, CA), spleen tyrosine kinase (Syk), phospho-Syk (Tyr525/526), Rab5 (Cell Signaling Technology, Danvers, MA), IFN regulatory factor 3 (IRF3), and C1q Ab (Abcam) were all obtained from commodity.

Plasmids and other DNA ligands

All oligonucleotides were synthesized by Sangon Biotech (Shanghai, China), with p-thio linkages represented as lowercase: IFN-stimulating DNA (ISD) (sense), 5′-TACAGATCTACTAGTGATCTATGACTGATCTGTACATGATCTACA-3′; CpG-B, 5′-TCCATGACGTTCCTGACGTT-3′. Equimolar amounts of ISD and their antisense oligos were annealed in PBS at 75°C for 30 min before cooling to room temperature. ISD-reverse was the exact reverse sequence of that listed earlier. poly(dA-dT)·poly(dT-dA) was obtained from Sigma-Aldrich. Plasmid pGL4.17 was obtained from Promega (Madison, WI). DNA vaccine pVAX-HBs was constructed by inserting a cDNA fragment encoding hepatitis B virus surface Ag (HBsAg) into pVAX1 (Invitrogen) in our previous studies (30). All plasmids were isolated using an Endo-free Plasmid Mega Kit (Qiagen China, Shanghai, China). For confocal analysis, DNA was labeled with FITC using Label-it Fluorescence Kit (Mirus Bio, Madison, WI) as recommended by the manufacturer.

Cytokines measurements

Cytokines mRNA was determined by quantitate RT-PCR (primers pairs shown in Supplementary Table I) with Step-one Plus Real-Time PCR Systems (Applied Biosystems, Carlsbad, CA). TNF-α, IL-6, and IFN-β protein expression level was also determined by ELISA (BD Pharmingen).

Evaluation of transcription factor activity

For IRF3 activation, whole-cell lysates from monocyte-derived macrophages (MDMs) stimulated for the indicated times were separated by SDS-PAGE or native PAGE, transferred to polyvinylidene difluoride membranes, and probed with Abs specific for the indicated proteins. For NF-κB activation, EMSA was performed with standard techniques; the sequence of NF-κB probe (sense) is 5′-AGT TGA GGG GAC TTT CCC AGG C-3′. NF-κB activation was also quantified by way of ELISA using the TransAM NF-κB p65 Transcription Factor Assay Kit (Active Motif, Carlsbad, CA), according to the manufacturer’s instructions.

Protein-DNA binding assays

For immunoprecipitation, HMGB1 (1 μg) and LL37 (1 μg) were each incubated with SAP (1 μg) protein in Tris-sodium-calcium (TSC) buffer (10 mM Tris, 140 mM NaCl, 2 mM CaCl2, 0.1% NaN3, pH 8.0) for 30 min and then incubated with anti-SAP Ab for 30 min. The complexes were immunoprecipitated with protein G UltraLink Resin or Streptavidin UltraLink Resin as a control (Pierce Biotechnology, Rockford, IL). For the competitive EMSA, biotin-labeled LL37 (1 μg) and ISD (0.2 μg) were incubated with increasing amounts of SAP and then separated on an 8% native PAGE gel in 45 mM Tris-borate buffer (without EDTA, pH 8.0). The biotin-labeled LL37 migration was visualized after HRP-labeled streptavidin straining. For the competitive ELISA, HMGB1 (1 μg) or LL37 (1 μg) was coated onto 96-well plates, and binding of biotin-labeled ISD was detected with HRP-labeled streptavidin (KPL, Gaithersburg, MD). In the inhibition assay, SAP was incubated with biotin-labeled ISD with or without 10 nM CHPHC, which was then added to coated plates.

DNA uptake and stimulation in vitro

Uptake of FITC-labeled plasmid by cells was determined by FACS analysis as described previously (31). To remove extracellular DNA, we washed cells three times with PBS containing dextran sulfate (100 μg/ml). In some cases, cells were treated with methyl-β-cyclodextrin (1 mM), amiloride (2.5 mM), wortmannin (20 μM), latrunculin A (2.5 μM), piceatannol (25 μM), polyguanylic acid (polyG; 500 μg/ml; all from Sigma-Aldrich), soluble IgG (10 mg/ml IVIg; Shanghai Institute of Biological Products), and soluble advanced glycosylation end product-specific receptor (sRAGE; 5 μg/ml; BioVendor Laboratory Medicine, Czech Republic) for 30 min before incubation and during uptake experiments. The peptides LL37 (40 μg/ml), HMGB1 (10 μg/ml; GenWay Biotech, San Diego, CA), and hSAP (40μg/ml) were individually preincubated with FITC-labeled DNA (8 μg/ml) for 10 min in TSC buffer before being added to the culture.

Confocal microscopy

MDMs were differentiated on glass coverslips in 24-well plates as described previously (26). hSAP (10 μg/ml) and FITC-labeled DNA (8 μg/ml) were preincubated in TSC buffer at 37°C for 10 min and then incubated with cells at 37°C, 5% CO2 for 5 or 15 min. The cells were then fixed and stained using anti-SAP mAb and other Abs. In some cases, Texas Red-conjugated transferrin (10 μg/ml) was also added into the medium as recommended by the manufacturer. For chloroquine treatment, 100 μg/ml chloroquine was administered in cell culture for 30 min and then removed by PBS washing. An inverted Leica TCS SP2 AOBS confocal microscope (DMIRE2; Wetzlar, Germany) with an HCX PL APO lbd. BL 63×/1.4 oil immersion objective was used. Images were collected with Leica Imaging Software (CTRMIC; TCS SP2). Representative images were processed in Photoshop (Adobe Systems, San Jose, CA) applying only linear corrections.

SAP-DNA binding analyses

The binding of hSAP to DNA was evaluated using dot blot and gel retardation analysis as previously described (32). For dot blot, all DNA blots were incubated with 10% human serum diluted with TSC buffer for 30 min and then visualized with a SAP-specific Ab. For gel retardation analysis, DNA (0.2 μg) was incubated with purified SAP or 5% serum in TSC buffer for 10 min and then separated on 5% native PAGE in 45 mM Tris-borate buffer (without EDTA, pH 8.0). DNA migration was visualized after ethidium bromide straining on a UV board. Three pGL4.17-derived DNA fragments used in gel retardation analysis were obtained by PCR.

DNA cloning and transfection

Full-length cDNA of FcγRIa, FcγRIIa, FcγRIIb, FcγRIIIa, scavenger receptor A (SRA), and advanced glycosylation end product-specific receptor (AGER) genes were obtained using RT-PCR from THP-1 total RNA and then inserted into pcDNA3.1(−)-flag (Invitrogen). The expressing plasmids were transfected into HEK293 cells with Lipofectamine 2000 (Invitrogen) according to the manufacturer’s instructions, and the expression levels of these receptors were confirmed by RT-PCR.

Animal experiments

Mice were maintained under specific pathogen-free conditions, and the experimental protocols were approved by the Second Military Medical University Institutional Animal Care and Use Committee. For immune stimulation in vivo, mice were intravenously injected with B-form DNA (B-DNA; 5 μg/g), and sera were collected by tail bleeding immediately or 6 h after injection. For DNA vaccine immunization, 50 μg pVAX-HBs was inoculated into the quadriceps every 2 wk three times. In some cases, CHPHC (50 μg/g) was also involved in the formulation of B-DNA or DNA vaccines.

Immunoassays

HBsAg-specific Ab analysis, spleen Ag-specific IFN-γ production, and Ag-specific CTL activity was performed as we previously described (11, 30). In brief, sera from the immunized mice were collected by tail bleeding 2 wk after last immunization for anti-HBsAg Ab ELISA assay. For the Ag-specific CTL activity, splenocytes from each mouse were separated at week 1 after the final immunization. A murine melanoma cell line B16 (H-2b) stable expressing HBsAg (B16/S cell) was used as target cells for HBsAg-specific CTLs. After a stimulation of splenocytes with peptides for 7 d in vitro, 1 × 105 CTL effector cells were cocultured with 2 × 103 B16/S cells in 200 μl medium per well for 4 h. Cytotoxic activity of CTL was tested by a colorimetric assay (Roche Applied Science, Mannheim, Germany), which is based on the measurement of lactate dehydrogenase activity released from the cytoplasm of damaged cells, and the percentage of specific lysis was calculated as described previously (30). For the specific IFN-γ assays, bulk splenocytes were then cultured for 24 h at 37°C with 5% CO2 in the presence of 10 μg/ml peptides. Then the supernatant was collected and determined using commercially available ELISA kits (R&D Systems, Minneapolis, MN) according to their manuals. The stimulating peptide is the 8-mer peptide ILSPFLPL (HBsAg S208-215) (33).

Statistical analysis

Differences between the groups were analyzed for statistical significance by the two-tailed unpaired Student t test, using SPSS 11.5 software.

Results

hSAP attenuates the immunogenicity of HBsAg DNA vaccine in vivo

In our study, we first confirmed the DNA-binding ability of hSAP and mSAP with various kinds of DNA, and our data indicated a length- and sequence-independent universal DNA-binding ability of hSAP (Supplemental Fig. 1). Consist with previous reports, purified mSAP did not show a significant DNA-binding ability (Supplemental Fig. 1), which also confirmed the species-specific DNA-binding ability of SAP. We also found that hSAP’s DNA-binding ability was strongly inhibited by the presence of CHPHC (a SAP-specific inhibitor that cross-links and dimerizes SAP molecules) (29) (Supplemental Fig. 1C), which could be a potential chemical inhibitor for hSAP in this study.

Basing on these results, we then investigated the effort of hSAP on the immunogenicity of DNA vaccines in vivo using a humanized mouse model expressing hSAP (Supplemental Fig. 2). We used an HBsAg-producing plasmid (pVAX1-HBs) as a model vaccine for i.m. inoculation into the hSAP Tg mice. When wild-type (WT) mice were immunized with pVAX-HBs, their IgG titers against the encoded HBsAg protein were significantly augmented in serum; however, titers in hSAP Tg mice were significantly lower than these in the WT mice (Fig. 1A). The isotypes of HBsAg-specific IgG had a similar change (Fig. 1B). For cellular immunity, the secretion of IFN-γ by splenocytes (Fig. 1C), and the frequency and cytotoxicity of Ag-specific CD8+ T cells (Fig. 1D) from hSAP Tg mice was also significantly lower than those from the control groups. These results demonstrate that hSAP Tg mice elicited significantly weaker humoral and cellular immune responses than WT mice. We also found that HBsAg-specific immune responses in CHPHC-administered hSAP Tg mice reverted to the level observed in WT mice. We therefore suggest that hSAP may inhibit the immunogenicity of HBsAg-expressing DNA vaccines in vivo, and the SAP inhibitor may play a role in the improvement of DNA vaccine efficacy.

FIGURE 1.
FIGURE 1.

hSAP inhibited the immunogenicity of DNA vaccines in vivo in Tg mice. hSAP Tg mice and WT mice (five per group) were i.m. immunized with a DNA vaccine encoding HBsAg protein (pVAX-HBs) on days 0, 14, and 28. In two groups, a SAP inhibitor CHPHC was also involved in the formulation of DNA vaccines. Fourteen days after the third immunization, the Ag-specific Ab (A, B), the HBsAg-specific IFN-γ production (C) by spleen cells, and the Ag-specific CTL activity (D, representative individual data with [filled symbols] or without [open symbols] HBsAg peptide) were analyzed. HBsAg-specific IgG titers (A), including their isotypes (B), were analyzed by ELISA. Data are the averages and SD of five mice per group. **p < 0.01 against control group (pVAX-HBs with buffer-immunized mice).

hSAP inhibits DNA-mediated innate immune responses in vitro

We then wondered about the mechanism of hSAP-induced suppression to DNA vaccines. Previous studies have shown that plasmid-DNA–activated innate immune responses and the resultant type I IFNR-mediated signaling is necessary for the optimal immunogenicity of DNA vaccine (11). Recent studies have also shown that aggregated SAP alone can stimulate the productions of IL-10, IL-8, and IL-6 by CD14+ monocytes via the FcγRIIa–Syk signaling pathway (26). We therefore wanted to know whether SAP–DNA complexes can also induce innate immune activation. In this regard, we examined macrophage cytokine production after DNA–SAP complex stimulation using human promonocytic cell line THP-1–derived macrophages (MDMs) as cell models, which express various DNA sensors and strongly respond to immune-stimulating DNA, including TLR9 agonist oligonucleotides with p-thio linkages (CpG-B) and B-DNA such as ISD and poly(deoxyguanylic-deoxycytidylic) acid. The hallmark of the innate immune responses activated by these receptors is the induction of type I IFNs, proinflammatory cytokines and chemokines (6). Interestingly, we found that MDMs in the presence of hSAP showed no augmented activation but showed a significant defect in mRNA induction for type I IFNs and a chemokine CCL5 in response to extracellular B-DNA at all doses examined, whereas the MDM response to DNA remained unaffected in the presence of mSAP (Fig. 2A). Similar results were also obtained on stimulation of MDMs with CpG-B in the presence of hSAP or mSAP (Fig. 2B). At the same time, we also found that an immune inhibitory cytokine, IL-10, was significantly increased after hSAP-DNA stimulation (Fig. 2C) and was previously reported to be induced by aggregated SAP (26). All of these data suggest that hSAP inhibits DNA-mediated immune activation.

FIGURE 2.
FIGURE 2.

hSAP inhibited DNA-mediated innate immune activation in vitro. A–C, THP-1 MDMs were stimulated with CpG-B and B-DNA for 6 h in the presence of hSAP, mSAP, or nothing. The relative expression level of cytokine mRNA was determined by quantitative real-time RT-PCR. The relative expression levels were assayed using the 2−ΔΔCt method and are presented as mean values and SD based on three independent experiments. *p < 0.05, **p < 0.01 compared with DNA-stimulated MDMs (two-tailed unpaired t test). D, DNA–hSAP complexes were incubated with MDMs, and IRF3 and NF-κB activation was determined with Western blotting and EMSA, respectively. ND, not detected.

We next examined whether the signaling pathways activated through the cytosolic receptors are affected by hSAP. The activation of the transcription factors IRF3 and NF-κB was measured in MDMs stimulated by B-DNA or CpG-B in the presence of hSAP. As shown in Fig. 2D, the formation of dimerized IRF3, a hallmark of IRF3 activation, was strongly suppressed in hSAP-DNA–stimulated MDMs but robust in normal MDMs on stimulation with ISD. Similarly, the activation of NF-κB was also suppressed in hSAP-DNA–stimulated MDMs (Fig. 2D). Thus, these results indicate that, in the context of the DNA-mediated activation of innate immune responses, hSAP plays an inhibitory role in the cytosolic receptor–IRF3/NF-κB signaling pathways.

hSAP competitively inhibits the DNA-binding ability of HMGB1 and LL37

Previous studies have shown that extracellular DNA-binding proteins and peptides, such as HMGB1 and LL37, can facilitate DNA uptake and contribute to DNA innate immune recognition. However, our results suggested that another extracellular protein, SAP, may play a role as an inhibitory protein. It was therefore important to determine how these extracellular DNA-binding proteins interacted. We investigated the DNA-sentinel attributes of HMGB1 and LL37 in the presence of SAP. As shown in Fig. 3A, IFN-β protein secretion after stimulation with B-DNA was significantly lower in the presence of hSAP than in the presence of mSAP or the control protein human CRP. This inhibition can also be abolished using the SAP inhibitor CHPHC, which further suggests the requirement for a natural pentamer structure during the process. We next examined whether the signaling pathways activated through the HMGB1 or LL37 and cytosolic DNARs are affected by hSAP. Activation of the IRF3 and NF-κB transcription factors was measured in MDMs stimulated by ISD or CpG-B. hSAP strongly suppressed the formation of dimerized IRF3 in either HMGB1– or LL37–ISD complex-stimulated MDMs (Fig. 3B). Similarly, the DNA-binding ability of NF-κB was also suppressed in the presence of hSAP (Fig. 3C). These results indicate that, in the context of the nucleic-acid–mediated activation of innate immune responses, SAP negatively regulates the cytosolic receptor–IRF3/NF-κB signaling pathways.

FIGURE 3.
FIGURE 3.

hSAP competitively inhibited the DNA-binding ability of HMGB1 and LL37. A, THP-1 MDMs were stimulated with B-DNA for 24 h in the presence of the different proteins and inhibitors shown. Supernatant IFN-β protein levels were determined by ELISA. The concentrations are shown as mean values and SD. *p < 0.05, **p < 0.01 (two-tailed unpaired t test). B, LL37- or HMGB1-mediated IRF3 activation in MDMs was determined with Western blotting after B-DNA stimulation. C, The DNA-binding activity of NF-κB p65 in CpG-B–stimulated MDMs was quantified using an ELISA. The fold changes were shown as mean values and SD based on three independent experiments. *p < 0.05, **p < 0.01 (two-tailed unpaired t test). D, Immunoblot analysis of human serum to detect the association of HMGB1, LL37, and SAP with immunoprecipitated (IP) SAP. hSAP competitively inhibits the DNA-binding ability of LL37 as demonstrated using an EMSA assay with biotinylated LL37 (bio-LL37). E, Binding of HMGB1 and LL37 to biotinylated DNA was detected with HRP-labeled streptavidin in the presence of 0–20 μg hSAP, mSAP, or hSAP with 10nM CHPHC. The absorbance at 450 nm is shown as the mean values and SD based on three independent experiments. *p < 0.01 (two-tailed unpaired t test), significant differences between groups. Control, streptavidin UltraLink Resin; Protein G, protein G UltraLink Resin.

We next examined the mechanism of SAP-mediated inhibition of HMGB1 and LL37 function. As SAP has a wide spectrum of ligands, including alarmins, C1q, and many other endogenous proteins (25), we determined whether hSAP could directly bind to the two proteins. We used HMGB1- and LL37-containing human serum to detect the association of HMGB1, LL37, and SAP with an immunoprecipitation analysis, using C1q as a positive control protein. We did not detect HMGB1 or LL37 binding with immunoprecipitated SAP. This result indicates that hSAP does not bind HMGB1 or LL37 directly (Fig. 3D).

We next hypothesized that SAP in complex with DNA might competitively inhibit the function of other DNA-binding proteins. To investigate this hypothesis, we incubated biotin-labeled LL37 with ISD in the presence of increasing amounts of hSAP and then separated the complexes on native PAGE gels. We found that free biotin-labeled LL37 was significantly augmented with increased hSAP, which indicates that LL37 was released from the complexes in the presence of hSAP (Fig. 3D). We also compared the binding of immobilized HMGB1 or LL37 to biotin-labeled ISD in the presence of hSAP or mSAP with a competitive ELISA assay. Consistent with the gel-retention results, we found that the amount of bound DNA significantly decreased when the concentration of hSAP was increased; mSAP and CHPHC-treated hSAP did not have this effect (Fig. 3E). These results indicate that the DNA-binding ability of both HMGB1 and LL37 can be inhibited by hSAP under physiological conditions.

hSAP changes DNA uptake manner from macropinocytosis to endocytosis

To further study the mechanism of SAP-mediated inhibition to innate immune activation, we investigated the interactions between hSAP–DNA complex and macrophages. Previous studies have shown that hSAP can bind CD14+ PBMCs and opsonize the ligand zymosan for phagocytosis (24–26, 34). Therefore, we explored whether the hSAP in DNA–protein complexes regulates the uptake of DNA by macrophages. The DNA uptake efficiency was determined by flow cytometry using fluorescently labeled DNA. We also used HMGB1 and LL37 to simulate physiological transfection agents based on the previous reports. However, the intracellular DNA did not increase in the presence of hSAP (data not shown). As endocytic naked DNA is always degraded rapidly by endosomal nucleases, we used chloroquine to prevent endosome acidification. We then observed that hSAP significantly increased the intracellular fluorescence rates of MDMs (Fig. 4A), suggesting that hSAP facilitates DNA uptake by macrophages but degraded in endosome subsequently. These findings were further confirmed using confocal microscopy (Fig. 4C), and we also found that the hSAP–DNA complex was well correlated with early endosome markers, transferrin, and early endosome Ag 1 in a colocalization analysis (Fig. 4D). Studies with mouse macrophages had similar results (Supplemental Fig. 3), which indicated that this mechanism may also be involved in our investigations in hSAP Tg mice. We also used CpG-B, an oligonucleotide with p-thio linkages that is resistant to nuclease. A time-dependent increase of the intracellular CpG-B in MDMs was observed, but the fluorescence rate was not significantly increased in the presence of hSAP when compared with the untreated cells (Fig. 4B). The results indicated that DNA with phosphorothioate backbone has a different uptake mechanism from native B-DNA.

FIGURE 4.
FIGURE 4.

hSAP facilitates plasmid DNA endocytosis. FITC-labeled B-DNA or CpG-B was coincubated with hSAP or other proteins and then was added to THP-1 MDMs for 5 min, 30 min, or 4 h. In some cases (A, C–E), MDMs were treated with chloroquine (100 μg/ml) before DNA incubation. The intracellular DNA was determined with flow cytometry (A, B, E). C and D, MDMs were strained with Abs and observed with confocal microscopy. All samples were tested in duplicate, and the colocalization results were shown as the representative pictures. E, hSAP facilitates DNA endocytosis, whereas LL37 facilitates DNA macropinocytosis. MDMs were respectively treated with the shown inhibitors before incubation. The FITC-labeled B-DNA was used and the fluorescence-positive cell rates are shown as mean and SD based on three independent experiments. *p < 0.05, **p < 0.01 (two-tailed unpaired t test). Scale bars, 10 μm.

Aiming to identify the mechanism of SAP-mediated B-DNA uptake, we studied the manners of MDM DNA uptake in the presence or absence of SAP. Previous studies have indicated the involvement of membrane raft-dependent macropinocytosis (8) in DNA uptake. Therefore, we studied the SAP-mediated DNA uptake by MDMs in the presence of various inhibitors for macropinocytosis. Methyl-β-cyclodextrin is a well-established, cholesterol-depleting agent used for studying the involvement of rafts/caveolae in cellular transport (35). Cell treatment with this agent did not significantly reduce SAP-mediated DNA uptake (Fig. 4E). Cells treated with amiloride, which specifically inhibits the Na+/H+ exchange required for macropinocytosis (8), also showed no significant reduction of SAP-mediated DNA uptake. Treatment with latrunculin A, which disrupts actin filaments, and wortmannin, which inhibits PI3K activation, resulted in about 25 and 30% reductions of SAP-mediated uptake, respectively (Fig. 4E). These data indicate that SAP-mediated DNA uptake may not require active Na+/H+ exchange and intact lipid rafts, suggesting that macropinocytosis may not be involved in the process. We also found that uptake partly requires an intact actin cytoskeleton and PI3K activation, suggesting that receptor-mediated endocytosis plays a role. For LL37 preincubated DNA, methyl-β-cyclodextrin, amiloride, and latrunculin A treatments all resulted in significant decrease of DNA uptake (Fig. 4E), which is consistent with the previous report that LL37 facilitates DNA uptake via macropinocytosis (31). All those results indicated that the DNA uptake manner of MDMs changed to endocytosis in the presence of SAP.

hSAP facilitates DNA endocytosis mainly in an FcγR-dependent manner

To further determine the dependent receptors of SAP-mediated DNA uptake, we used IVIg (7), polyG (36), sRAGE (37), and piceatannol (7) to inhibit FcRs, scavenger receptors, AGER, and the FcR adaptor Syk, respectively (Fig. 5A). In the absence of SAP, only cells treated with sRAGE or polyG showed a significant reduction of native DNA uptake, and this result is consistent with previous reports on the role of the HMGB1–RAGE interaction (38) and scavenger receptors in DNA uptake (39). However, in the presence of SAP, the DNA uptake increase could only be inhibited by IVIg and piceatannol, which suggests that FcRs play a key role in SAP-mediated DNA uptake (Fig. 5A). The data also indicate that scavenger receptors and AGER-mediated DNA uptake is inhibited in the presence of SAP. We also examined whether activation of the Syk signaling pathways through the FcRs is affected by the hSAP–DNA complex. We found that hSAP alone induced significant Syk activation, and at the same time, both the hSAP–CpG-B and hSAP–ISD complexes have a weaker but definite ability to activate Syk (Fig. 5B).

FIGURE 5.
FIGURE 5.

hSAP facilitates plasmid DNA endocytosis via FcRs. A, FITC-labeled DNA was coincubated with hSAP and then added to THP-1 MDMs in the presence of the specific inhibitors for AGER, FcγRs, and scavenger receptors. The intracellular DNA was determined with flow cytometry. The fluorescence-positive cell rates are shown as mean and SD based on three independent experiments. *p < 0.05, **p < 0.01 (two-tailed unpaired t test). B, hSAP, DNA, and their complexes were incubated with MDMs for 10 min, and Syk activation was determined by assessing the phospho-Syk (p-Syk,Tyr525/526) level by Western blotting. C, HEK293 cells transfected with different receptors were incubated with FITC-labeled DNA in the presence of hSAP or CRP, and the plasmid pcDNA3.1(–)-flag was used as a negative control (NC). The fluorescence-positive cell rates are shown (mean values and SD). *p < 0.05, **p < 0.01 (two-tailed unpaired t test). All samples were tested in duplicate.

To further identify the dependent receptors, we cloned a group of receptors including FcγRIa, FcγRIIa, FcγRIIb, FcγRIIIa, SRA, and AGER, and transfected them into HEK293 cells. Those receptor-transfected cell models were used to study the hSAP-DNA uptake efficiencies with CRP, another short pentraxin without DNA-binding ability, as a control. Our results indicated that only the cells overexpressing FcγRIa and FcγRIIIa had an increased ability to uptake the hSAP–DNA complex (Fig. 5C), which also suggests that the FcγRs play a role in SAP-mediated DNA uptake.

hSAP suppression promotes innate immune responses to DNA under physiological conditions

For ethical reasons, it is still not possible to further determine the role of hSAP in the regulation of immune responses to DNA vaccine in clinical investigations. However, in this study, we further investigated the innate immune responses to DNA under a simulated natural environment in human body. We added human serum from healthy individuals into the MDM culture, and we found that DNA-induced immune response, including the CpG-B–induced CCL5, TNFA, and IL-6 mRNA production or the ISD-induced IFN-B1, IFN-A4, and IL-6 mRNA production was significantly inhibited in the presence of human serum. However, with increasing doses of CHPHC, we found a significant increase of cytokine mRNA after DNA stimulation (Fig. 6A). These results indicate that some agents in natural serum inhibit the DNA-induced immune response, and that SAP-specific inhibition may break the physiological barrier to induce immune activation, further suggesting the role of SAP in the negative regulation of DNA-sensing systems.

FIGURE 6.
FIGURE 6.

hSAP in negative regulation of innate immune responses. A, THP-1 MDMs were stimulated with CpG-B or ISD with 10% human serum in the presence or absence of the SAP inhibitor CHPHC. Cytokine mRNA expression was determined by quantitative real-time RT-PCR. The relative expression levels were assayed using the 2−ΔΔCt method and are shown as mean values and SD based on three independent experiments. B, Mice (five per group) were i.v. injected with B-DNA in the presence or absence of the CHPHC. The serum cytokines levels were determined by ELISA and are shown as mean values and SD based on three independent experiments. **p < 0.01, two-tailed unpaired t test, significant differences between groups. ND, not detected.

We also investigated the effects of SAP-specific inhibition on the innate immune activation by B-DNA in vivo in the hSAP Tg mice. We found that i.v. injection of B-DNA induced a significant increase of serum IL-6 and TNF-α levels in the WT mice, but the response was much weaker in the hSAP Tg mice. However, the coadministration of CHPHC partly recovered the B-DNA–induced serum cytokines production in the hSAP Tg mice (Fig. 6B), and this result further indicates that hSAP inhibits innate immune recognition to B-DNA in vivo. Based on the previous results, we hypothesized that hSAP regulates DNA-induced immune responses by suppressing the functions of other extracellular DNA-binding proteins. A schematic view of this hypothesis is shown in Fig. 7.

FIGURE 7.
FIGURE 7.

Extracellular-protein–mediated regulation of innate immune recognition of DNA. A schematic view of our hypothesis about the extracellular protein-mediated regulation of the innate immune recognition of DNA, which includes positive sensing proteins (HMGBs, LL37) as “pass” signals and negative sensing proteins (SAP) as “arrest” signals. Arrest: In the normal human internal environment, SAP can bind the entire extracellular DNA and abolish the immune response activated by trace HMGBs and LL37. Pass: Under certain conditions, such as inflammation and tissue damage, the positive sensing proteins greatly increase and facilitate extracellular DNA vaccines to enter cells and induce immune activation. The two opposite arms control the balance of the nucleic acid-sensing system. AIM2, absent in melanoma 2; DAI, DNA-dependent activator of IRFs; RIG-I, retinoic acid-inducible gene I.

Discussion

The drive to improve DNA vaccine function is fueled by the consensus that DNA vaccines may be immunologically benign; that is, they are simply not carrying enough of the signals necessary to trigger a strong innate immune response (40). Thus, there is an urgent need for more robust and universally applicable adjuvant strategies to facilitate immune activation during DNA vaccination. However, despite the gradually uncovered mechanisms by which extracellular dsDNA activates innate immune responses, the agents that negatively regulate extracellular DNA sensing remain unclear. In this article, we have provided evidence that hSAP can universally inhibit the activation of various DNA sensors through a mechanism involving competitive inhibition of the DNA sentinels HMGB1 and LL37. As hSAP is proved to be the major extracellular DNA-binding protein naturally circulating in serum and presenting in normal extracellular matrix (22, 41, 42), we further suggest that hSAP may play a key role in the negative regulation of the innate immune response to DNA vaccines under physiological conditions.

It has been shown that free DNA and DNA sentinels, such as HMGB1 and LL37, normally exist in the extracellular environment and greatly increase during infection and tissue damage (7, 43). Because SAP is a natural constitutive component in human serum, we hypothesize that SAP can “arrest” those extracellular DNAs to avoid their binding with DNA sentinels and then forbid them from “passing” the barrier to activate innate immunity. Only when extracellular DNA or DNA sentinels greatly increase and exceed the threshold of SAP-binding ability can DNA be captured by HMGB1 and LL37 and engulfed to activate DNA sensors. The innate immune response may be subsequently initiated. This hypothesis may partly explain the previous findings that multiple high doses of DNA vaccine are always necessary to increase immune efficacy in many human applications (44). In this regard, we suggest that hSAP may play a key role in the regulation of the immune responses to DNA vaccine under physiological conditions.

For the mechanism of innate immune suppression induced by SAP, we compared the different uptake manners between SAP and other DNA-binding proteins. It is shown that HMGB1 and LL37 facilitate DNA uptake mainly though a macropinocytosis manner, which increases cytosolic DNA concentrations with a “leakage” mechanism (8, 31) and then facilitates DNA sensor activation. However, in our findings, SAP competitively inhibits the function of HMGB1 and LL37, and facilitates DNA’s uptake via endosomal pathways leading to degradation. We therefore suggest that it may also be a potential mechanism of SAP-mediated inhibition to innate immune recognition of DNA.

Opsonization by SAP is controversial in the literature. Many studies have shown that SAP opsonizes apoptotic cells and zymosan through FcγRs (24, 26, 45), but in contrast, SAP has been shown to be a potent antiopsonin (46) in many other reports. Specifically with respect to genomic DNA, SAP has been reported to protect chromatin against degradation (47). In this study, we observed the engulfment of SAP-opsonized B-DNA by human MDMs and found that the SAP–DNA complex localized in the early endosome. However, the amounts of engulfed DNA in MDMs did not significantly change in the presence or absence of hSAP, which indicates that SAP-mediated endocytosis is inefficient in DNA uptake. For CpG-B DNA, we even found that hSAP inhibited their uptake by MDMs. We therefore assume that most of the SAP–DNA complex may not be phagocytosed immediately and may be gradually cleared by macrophages for a long period. Because rapid engulfment of a large amount of DNA may induce unexpected overactivation of the innate immune response, the “slow-clearance” mechanism of the SAP–DNA complex may also be helpful for maintaining the balance of DNA-related immunity during infection and tissue damage.

There is another interesting problem to be discussed. Although we observed the engulfment of SAP-opsonized B-DNA by human MDMs and found that the SAP–DNA complex localized in the early endosome, these DNAs did not activate endosomal DNA sensors, such as TLR9. Based on previous CpG-A data, multivalent higher order structures of DNA may be necessary for TLR9 cross-linking and activation (48). We believe that the SAP–DNA complex may alter the formation of DNA higher order structures and affect the TLR9–DNA interaction in the early endosome because SAP is strongly resistant to protease degradation. Whether SAP inhibits DNA from assembling into larger, multivalent complexes remains to be determined.

Previous studies have shown that aggregated SAP alone can stimulate the production of IL-10, IL-8, and IL-6 by CD14+ monocytes via the FcγR-dependent pathway. However, in this study, although we also confirmed that hSAP facilitates DNA endocytosis via FcRs, we found that hSAP inhibits IL-6 production but stimulates IL-10 production when it complexes with DNA. The differences may be related to the structure alternation of the SAP–DNA complex. Aggregated SAP without ligands has been shown to have little binding activity for FcγRIIb, the human inhibitory receptor, but has the greatest affinity for the activating receptors FcγRIIa and FcγRIIIa (26, 45). However, the preference of SAP may be altered after binding with DNA. SAP shows an impaired ability to activate Syk in the presence of DNA ligands, which further suggests the difference between the SAP–DNA complex and SAP alone. The problem needs further study to examine alterations in the molecular structure.

The different activity of SAP between human and mouse has long been known, but it is still interesting to imagine that it contributes to the species-specific efficiency of DNA vaccines. In previous studies, SAP-deficient mice developed higher titers of autoantibodies against nuclear debris than WT mice; the authors proposed that SAP, by stabilizing and transporting chromatin to the liver for catabolism, may prevent the formation of Abs against DNA (47). However, further studies indicated that most of the autoimmunity originally reported in SAP-knockout mice was due to genetic effects of the mouse strain background and not SAP deficiency (23, 49). As such, the role of mSAP in DNA clearance is ambiguous. In this study, we found that mSAP has no significant function in the innate immune response to DNA, which further suggests that hSAP has a species-specific ability to regulate DNA immunity. These findings may have implications for understanding the evolution of the innate immune system.

As Wolfgang W. Leitner previously claimed (40), the honeymoon period that vaccinologists had with the new technology of DNA immunization is over with the realization that DNA vaccines were not as effective in human clinical trials as they were in mouse-based studies. Finding some ways to overcome the species-specific obstacles is therefore an urgent problem in current vaccine studies. Although various attempts have been made to find adjuvant strategies that will enhance the immunogenicity of plasmid DNA vaccines, and some of them, such as the electroporation, liposomes, and polymers, have entered into a variety of human clinical trials (5), there are still many problems for the clinical applications of those strategies, especially in developing countries. Improved chemical adjuvants, which should be more convenient, effective, and painless, may allow plasmid DNA to become an essential tool for combating a variety of infectious diseases (5). In this study, we identified a chemical developed to remove amyloid plaques, CHPHC, that inhibited SAP binding to DNA and promoted immune responses to DNA vaccines in vivo. A recent clinical investigation has confirmed the safety of CHPHC administration in vivo (41); therefore, we suggest that CHPHC might be valuable for enhancing the efficiency of DNA immunizations in humans and requires further clinical investigations. We also hypothesize that DNA vaccines could be improved by including special nanomaterials that can prevent DNA vaccines from being bound by hSAP. This strategy is a focus of future investigations in our laboratory.

Disclosures

The authors have no financial conflicts of interest.

Acknowledgments

We thank Drs. Jing Zhao and Min Guan for generating hSAP Tg mice and Dr. Wenfeng Liu for good work on CHPHC synthesis. We also thank Profs. Fang Wang and Shuxia Song for precious suggestions.

Footnotes

  • This work was supported by the Key Program (30530660) from the National Natural Science Foundation of China and the Basic Research Program (04JC14004) from the Science and Technology Commission of Shanghai. The funders of this work had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.

  • The online version of this article contains supplemental material.

  • Abbreviations used in this article:

    AGER
    advanced glycosylation end product-specific receptor
    B-DNA
    B-form DNA
    CHPHC
    R-1-[6-[R-2-carboxy-pyrrolidin-1-yl]-6-oxo-hexanoyl] pyrrolidine-2-carboxylic acid
    CRP
    C-reactive protein
    HBsAg
    hepatitis B virus surface Ag
    HMGB
    high-mobility group B protein
    hSAP
    human serum amyloid P component
    IRF
    IFN regulatory factor
    ISD
    IFN-stimulating DNA
    MDM
    monocyte-derived macrophage
    mSAP
    mouse serum amyloid P
    polyG
    polyguanylic acid
    SAP
    serum amyloid P
    SRA
    scavenger receptor A
    sRAGE
    soluble advanced glycosylation end product-specific receptor
    Syk
    spleen tyrosine kinase
    Tg
    transgenic
    TSC
    Tris-sodium-calcium
    WT
    wild-type.

  • Received November 3, 2010.
  • Accepted December 16, 2010.

References

  1. ↵
    1. Gurunathan S.,
    2. D. M. Klinman,
    3. R. A. Seder
    . 2000. DNA vaccines: immunology, application, and optimization*. Annu. Rev. Immunol. 18: 927–974.
    OpenUrlCrossRefPubMed
  2. ↵
    1. Donnelly J. J.,
    2. B. Wahren,
    3. M. A. Liu
    . 2005. DNA vaccines: progress and challenges. J. Immunol. 175: 633–639.
    OpenUrlAbstract/FREE Full Text
  3. ↵
    1. Rice J.,
    2. C. H. Ottensmeier,
    3. F. K. Stevenson
    . 2008. DNA vaccines: precision tools for activating effective immunity against cancer. Nat. Rev. Cancer 8: 108–120.
    OpenUrlCrossRefPubMed
  4. ↵
    1. Stevenson F. K.,
    2. C. H. Ottensmeier,
    3. J. Rice
    . 2010. DNA vaccines against cancer come of age. Curr. Opin. Immunol. 22: 264–270.
    OpenUrlCrossRefPubMed
  5. ↵
    1. Greenland J. R.,
    2. N. L. Letvin
    . 2007. Chemical adjuvants for plasmid DNA vaccines. Vaccine 25: 3731–3741.
    OpenUrlCrossRefPubMed
  6. ↵
    1. Yanai H.,
    2. T. Ban,
    3. Z. Wang,
    4. M. K. Choi,
    5. T. Kawamura,
    6. H. Negishi,
    7. M. Nakasato,
    8. Y. Lu,
    9. S. Hangai,
    10. R. Koshiba,
    11. et al
    . 2009. HMGB proteins function as universal sentinels for nucleic-acid-mediated innate immune responses. Nature 462: 99–103.
    OpenUrlCrossRefPubMed
  7. ↵
    1. Lande R.,
    2. J. Gregorio,
    3. V. Facchinetti,
    4. B. Chatterjee,
    5. Y. H. Wang,
    6. B. Homey,
    7. W. Cao,
    8. Y. H. Wang,
    9. B. Su,
    10. F. O. Nestle,
    11. et al
    . 2007. Plasmacytoid dendritic cells sense self-DNA coupled with antimicrobial peptide. Nature 449: 564–569.
    OpenUrlCrossRefPubMed
  8. ↵
    1. Wittrup A.,
    2. S. Sandgren,
    3. J. Lilja,
    4. C. Bratt,
    5. N. Gustavsson,
    6. M. Mörgelin,
    7. M. Belting
    . 2007. Identification of proteins released by mammalian cells that mediate DNA internalization through proteoglycan-dependent macropinocytosis. J. Biol. Chem. 282: 27897–27904.
    OpenUrlAbstract/FREE Full Text
  9. ↵
    1. Bauer S.,
    2. C. J. Kirschning,
    3. H. Häcker,
    4. V. Redecke,
    5. S. Hausmann,
    6. S. Akira,
    7. H. Wagner,
    8. G. B. Lipford
    . 2001. Human TLR9 confers responsiveness to bacterial DNA via species-specific CpG motif recognition. Proc. Natl. Acad. Sci. USA 98: 9237–9242.
    OpenUrlAbstract/FREE Full Text
  10. ↵
    1. Ishii K. J.,
    2. S. Akira
    . 2006. Innate immune recognition of, and regulation by, DNA. Trends Immunol. 27: 525–532.
    OpenUrlCrossRefPubMed
  11. ↵
    1. Ishii K. J.,
    2. T. Kawagoe,
    3. S. Koyama,
    4. K. Matsui,
    5. H. Kumar,
    6. T. Kawai,
    7. S. Uematsu,
    8. O. Takeuchi,
    9. F. Takeshita,
    10. C. Coban,
    11. S. Akira
    . 2008. TANK-binding kinase-1 delineates innate and adaptive immune responses to DNA vaccines. Nature 451: 725–729.
    OpenUrlCrossRefPubMed
    1. Takaoka A.,
    2. Z. Wang,
    3. M. K. Choi,
    4. H. Yanai,
    5. H. Negishi,
    6. T. Ban,
    7. Y. Lu,
    8. M. Miyagishi,
    9. T. Kodama,
    10. K. Honda,
    11. et al
    . 2007. DAI (DLM-1/ZBP1) is a cytosolic DNA sensor and an activator of innate immune response. Nature 448: 501–505.
    OpenUrlCrossRefPubMed
    1. Schroder K.,
    2. D. A. Muruve,
    3. J. Tschopp
    . 2009. Innate immunity: cytoplasmic DNA sensing by the AIM2 inflammasome. Curr. Biol. 19: R262–R265.
    OpenUrlCrossRefPubMed
    1. Choi M. K.,
    2. Z. Wang,
    3. T. Ban,
    4. H. Yanai,
    5. Y. Lu,
    6. R. Koshiba,
    7. Y. Nakaima,
    8. S. Hangai,
    9. D. Savitsky,
    10. M. Nakasato,
    11. et al
    . 2009. A selective contribution of the RIG-I-like receptor pathway to type I interferon responses activated by cytosolic DNA. Proc. Natl. Acad. Sci. USA 106: 17870–17875.
    OpenUrlAbstract/FREE Full Text
  15. ↵
    1. Chiu Y. H.,
    2. J. B. Macmillan,
    3. Z. J. Chen
    . 2009. RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway. Cell 138: 576–591.
    OpenUrlCrossRefPubMed
  16. ↵
    1. Ishii K. J.,
    2. C. Coban,
    3. H. Kato,
    4. K. Takahashi,
    5. Y. Torii,
    6. F. Takeshita,
    7. H. Ludwig,
    8. G. Sutter,
    9. K. Suzuki,
    10. H. Hemmi,
    11. et al
    . 2006. A Toll-like receptor-independent antiviral response induced by double-stranded B-form DNA. Nat. Immunol. 7: 40–48.
    OpenUrlCrossRefPubMed
    1. Ishii K. J.,
    2. K. Suzuki,
    3. C. Coban,
    4. F. Takeshita,
    5. Y. Itoh,
    6. H. Matoba,
    7. L. D. Kohn,
    8. D. M. Klinman
    . 2001. Genomic DNA released by dying cells induces the maturation of APCs. J. Immunol. 167: 2602–2607.
    OpenUrlAbstract/FREE Full Text
    1. Wang Z.,
    2. M. K. Choi,
    3. T. Ban,
    4. H. Yanai,
    5. H. Negishi,
    6. Y. Lu,
    7. T. Tamura,
    8. A. Takaoka,
    9. K. Nishikura,
    10. T. Taniguchi
    . 2008. Regulation of innate immune responses by DAI (DLM-1/ZBP1) and other DNA-sensing molecules. Proc. Natl. Acad. Sci. USA 105: 5477–5482.
    OpenUrlAbstract/FREE Full Text
  19. ↵
    1. Okabe Y.,
    2. K. Kawane,
    3. S. Akira,
    4. T. Taniguchi,
    5. S. Nagata
    . 2005. Toll-like receptor-independent gene induction program activated by mammalian DNA escaped from apoptotic DNA degradation. J. Exp. Med. 202: 1333–1339.
    OpenUrlAbstract/FREE Full Text
  20. ↵
    1. Barrat F. J.,
    2. T. Meeker,
    3. J. Gregorio,
    4. J. H. Chan,
    5. S. Uematsu,
    6. S. Akira,
    7. B. Chang,
    8. O. Duramad,
    9. R. L. Coffman
    . 2005. Nucleic acids of mammalian origin can act as endogenous ligands for Toll-like receptors and may promote systemic lupus erythematosus. J. Exp. Med. 202: 1131–1139.
    OpenUrlAbstract/FREE Full Text
  21. ↵
    1. Ivanov S.,
    2. A. M. Dragoi,
    3. X. Wang,
    4. C. Dallacosta,
    5. J. Louten,
    6. G. Musco,
    7. G. Sitia,
    8. G. S. Yap,
    9. Y. Wan,
    10. C. A. Biron,
    11. et al
    . 2007. A novel role for HMGB1 in TLR9-mediated inflammatory responses to CpG-DNA. Blood 110: 1970–1981.
    OpenUrlAbstract/FREE Full Text
  22. ↵
    1. Pepys M. B.,
    2. P. J. Butler
    . 1987. Serum amyloid P component is the major calcium-dependent specific DNA binding protein of the serum. Biochem. Biophys. Res. Commun. 148: 308–313.
    OpenUrlCrossRefPubMed
  23. ↵
    1. Gillmore J. D.,
    2. W. L. Hutchinson,
    3. J. Herbert,
    4. A. Bybee,
    5. D. A. Mitchell,
    6. R. P. Hasserjian,
    7. K. Yamamura,
    8. M. Suzuki,
    9. C. A. Sabin,
    10. M. B. Pepys
    . 2004. Autoimmunity and glomerulonephritis in mice with targeted deletion of the serum amyloid P component gene: SAP deficiency or strain combination? Immunology 112: 255–264.
    OpenUrlCrossRefPubMed
  24. ↵
    1. Bharadwaj D.,
    2. C. Mold,
    3. E. Markham,
    4. T. W. Du Clos
    . 2001. Serum amyloid P component binds to Fc gamma receptors and opsonizes particles for phagocytosis. J. Immunol. 166: 6735–6741.
    OpenUrlAbstract/FREE Full Text
  25. ↵
    1. Garlanda C.,
    2. B. Bottazzi,
    3. A. Bastone,
    4. A. Mantovani
    . 2005. Pentraxins at the crossroads between innate immunity, inflammation, matrix deposition, and female fertility. Annu. Rev. Immunol. 23: 337–366.
    OpenUrlCrossRefPubMed
  26. ↵
    1. Lu J.,
    2. L. L. Marnell,
    3. K. D. Marjon,
    4. C. Mold,
    5. T. W. Du Clos,
    6. P. D. Sun
    . 2008. Structural recognition and functional activation of FcgammaR by innate pentraxins. Nature 456: 989–992.
    OpenUrlCrossRefPubMed
  27. ↵
    1. Pepys M. B.,
    2. M. Baltz,
    3. K. Gomer,
    4. A. J. Davies,
    5. M. Doenhoff
    . 1979. Serum amyloid P-component is an acute-phase reactant in the mouse. Nature 278: 259–261.
    OpenUrlCrossRefPubMed
  28. ↵
    1. Pepys M. B.,
    2. M. L. Baltz,
    3. F. C. de Beer,
    4. R. F. Dyck,
    5. S. Holford,
    6. S. M. Breathnach,
    7. M. M. Black,
    8. C. R. Tribe,
    9. D. J. Evans,
    10. A. Feinstein
    . 1982. Biology of serum amyloid P component. Ann. N. Y. Acad. Sci. 389: 286–298.
    OpenUrlCrossRefPubMed
  29. ↵
    1. Pepys M. B.,
    2. J. Herbert,
    3. W. L. Hutchinson,
    4. G. A. Tennent,
    5. H. J. Lachmann,
    6. J. R. Gallimore,
    7. L. B. Lovat,
    8. T. Bartfai,
    9. A. Alanine,
    10. C. Hertel,
    11. et al
    . 2002. Targeted pharmacological depletion of serum amyloid P component for treatment of human amyloidosis. Nature 417: 254–259.
    OpenUrlCrossRefPubMed
  30. ↵
    1. Wang Y.,
    2. D. A. Li,
    3. Y. Hey,
    4. F. Wang,
    5. Y. J. Guo,
    6. F. Yang,
    7. Q. Zhou,
    8. S. H. Sun
    . 2007. Proteomic analysis of augmented immune responses in mouse by prime-and-boost immunization strategy with DNA vaccine coding HBsAg and rHBsAg protein. Vaccine 25: 8146–8153.
    OpenUrlCrossRefPubMed
  31. ↵
    1. Sandgren S.,
    2. A. Wittrup,
    3. F. Cheng,
    4. M. Jönsson,
    5. E. Eklund,
    6. S. Busch,
    7. M. Belting
    . 2004. The human antimicrobial peptide LL-37 transfers extracellular DNA plasmid to the nuclear compartment of mammalian cells via lipid rafts and proteoglycan-dependent endocytosis. J. Biol. Chem. 279: 17951–17956.
    OpenUrlAbstract/FREE Full Text
  32. ↵
    1. Trouw L. A.,
    2. S. C. Nilsson,
    3. I. Gonçalves,
    4. G. Landberg,
    5. A. M. Blom
    . 2005. C4b-binding protein binds to necrotic cells and DNA, limiting DNA release and inhibiting complement activation. J. Exp. Med. 201: 1937–1948.
    OpenUrlAbstract/FREE Full Text
  33. ↵
    1. Schirmbeck R.,
    2. J. Wild,
    3. J. Reimann
    . 1998. Similar as well as distinct MHC class I-binding peptides are generated by exogenous and endogenous processing of hepatitis B virus surface antigen. Eur. J. Immunol. 28: 4149–4161.
    OpenUrlCrossRefPubMed
  34. ↵
    1. Macdonald S. L.,
    2. D. C. Kilpatrick
    . 2006. Human serum amyloid P component binds to peripheral blood monocytes. Scand. J. Immunol. 64: 48–52.
    OpenUrlCrossRefPubMed
  35. ↵
    1. Ono A.,
    2. E. O. Freed
    . 2001. Plasma membrane rafts play a critical role in HIV-1 assembly and release. Proc. Natl. Acad. Sci. USA 98: 13925–13930.
    OpenUrlAbstract/FREE Full Text
  36. ↵
    1. Pearson A. M.,
    2. A. Rich,
    3. M. Krieger
    . 1993. Polynucleotide binding to macrophage scavenger receptors depends on the formation of base-quartet-stabilized four-stranded helices. J. Biol. Chem. 268: 3546–3554.
    OpenUrlAbstract/FREE Full Text
  37. ↵
    1. Zong H.,
    2. A. Madden,
    3. M. Ward,
    4. M. H. Mooney,
    5. C. T. Elliott,
    6. A. W. Stitt
    . 2010. Homodimerization is essential for the receptor for advanced glycation end products (RAGE)-mediated signal transduction. J. Biol. Chem. 285: 23137–23146.
    OpenUrlAbstract/FREE Full Text
  38. ↵
    1. Tian J.,
    2. A. M. Avalos,
    3. S. Y. Mao,
    4. B. Chen,
    5. K. Senthil,
    6. H. Wu,
    7. P. Parroche,
    8. S. Drabic,
    9. D. Golenbock,
    10. C. Sirois,
    11. et al
    . 2007. Toll-like receptor 9-dependent activation by DNA-containing immune complexes is mediated by HMGB1 and RAGE. Nat. Immunol. 8: 487–496.
    OpenUrlCrossRefPubMed
  39. ↵
    1. Takagi T.,
    2. M. Hashiguchi,
    3. R. I. Mahato,
    4. H. Tokuda,
    5. Y. Takakura,
    6. M. Hashida
    . 1998. Involvement of specific mechanism in plasmid DNA uptake by mouse peritoneal macrophages. Biochem. Biophys. Res. Commun. 245: 729–733.
    OpenUrlCrossRefPubMed
  40. ↵
    1. Leitner W. W.,
    2. N. P. Restifo
    . 2003. DNA vaccines and apoptosis: to kill or not to kill? J. Clin. Invest. 112: 22–24.
    OpenUrlCrossRefPubMed
  41. ↵
    1. Bodin K.,
    2. S. Ellmerich,
    3. M. C. Kahan,
    4. G. A. Tennent,
    5. A. Loesch,
    6. J. A. Gilbertson,
    7. W. L. Hutchinson,
    8. P. P. Mangione,
    9. J. R. Gallimore,
    10. D. J. Millar,
    11. et al
    . 2010. Antibodies to human serum amyloid P component eliminate visceral amyloid deposits. Nature 468: 93–97.
    OpenUrlCrossRefPubMed
  42. ↵
    1. Dyck R. F.,
    2. C. M. Lockwood,
    3. M. Kershaw,
    4. N. McHugh,
    5. V. C. Duance,
    6. M. L. Baltz,
    7. M. B. Pepys
    . 1980. Amyloid P-component is a constituent of normal human glomerular basement membrane. J. Exp. Med. 152: 1162–1174.
    OpenUrlAbstract/FREE Full Text
  43. ↵
    1. Scaffidi P.,
    2. T. Misteli,
    3. M. E. Bianchi
    . 2002. Release of chromatin protein HMGB1 by necrotic cells triggers inflammation. Nature 418: 191–195.
    OpenUrlCrossRefPubMed
  44. ↵
    1. Calarota S.,
    2. G. Bratt,
    3. S. Nordlund,
    4. J. Hinkula,
    5. A. C. Leandersson,
    6. E. Sandström,
    7. B. Wahren
    . 1998. Cellular cytotoxic response induced by DNA vaccination in HIV-1-infected patients. Lancet 351: 1320–1325.
    OpenUrlCrossRefPubMed
  45. ↵
    1. Castaño A. P.,
    2. S. L. Lin,
    3. T. Surowy,
    4. B. T. Nowlin,
    5. S. A. Turlapati,
    6. T. Patel,
    7. A. Singh,
    8. S. Li,
    9. M. L. Lupher Jr..,
    10. J. S. Duffield
    . 2009. Serum amyloid P inhibits fibrosis through Fc gamma R-dependent monocyte-macrophage regulation in vivo. Sci. Transl. Med. 1: 5ra13.
    OpenUrlAbstract/FREE Full Text
  46. ↵
    1. Noursadeghi M.,
    2. M. C. Bickerstaff,
    3. J. R. Gallimore,
    4. J. Herbert,
    5. J. Cohen,
    6. M. B. Pepys
    . 2000. Role of serum amyloid P component in bacterial infection: protection of the host or protection of the pathogen. Proc. Natl. Acad. Sci. USA 97: 14584–14589.
    OpenUrlAbstract/FREE Full Text
  47. ↵
    1. Bickerstaff M. C.,
    2. M. Botto,
    3. W. L. Hutchinson,
    4. J. Herbert,
    5. G. A. Tennent,
    6. A. Bybee,
    7. D. A. Mitchell,
    8. H. T. Cook,
    9. P. J. Butler,
    10. M. J. Walport,
    11. M. B. Pepys
    . 1999. Serum amyloid P component controls chromatin degradation and prevents antinuclear autoimmunity. Nat. Med. 5: 694–697.
    OpenUrlCrossRefPubMed
  48. ↵
    1. Wu C. C.,
    2. J. Lee,
    3. E. Raz,
    4. M. Corr,
    5. D. A. Carson
    . 2004. Necessity of oligonucleotide aggregation for toll-like receptor 9 activation. J. Biol. Chem. 279: 33071–33078.
    OpenUrlAbstract/FREE Full Text
  49. ↵
    1. Bygrave A. E.,
    2. K. L. Rose,
    3. J. Cortes-Hernandez,
    4. J. Warren,
    5. R. J. Rigby,
    6. H. T. Cook,
    7. M. J. Walport,
    8. T. J. Vyse,
    9. M. Botto
    . 2004. Spontaneous autoimmunity in 129 and C57BL/6 mice-implications for autoimmunity described in gene-targeted mice. PLoS Biol. 2: E243.
    OpenUrlCrossRefPubMed
Back to top

In this issue

Print
Download PDF
Article Alerts
Email Article
Citation Tools

Jump to section