Table I.

Plasmids used for immunization studies

DescriptionLeader SequenceaTh SequencebAntigenic Sequence
pCI-neo (empty vector)
pS.9MMRYMILGLLALAAVCSAAEFDYAWDQTHQDPAK
pT.9MMKLQYIKANSKFIGITELEFDYAWDQTHQDPAK
pST.9MMRYMILGLLALAAVCSAAQYIKANSKFIGITELEFDYAWDQTHQDPAK
p9MMDYAWDQTHQDPAK
pS.7MMRYMILGLLALAAVCSAAEFPPWDFDAGEGIHGDPAK
pT.7MMKLQYIKANSKFIGITELEFPPWDFDAGEGIHGDPAK
pST.7MMRYMILGLLALAAVCSAAQYIKANSKFIGITELEFPPWDFDAGEGIHGDPAK
p7MMPPWDFDAGEGIHGDPAK
pmIFN-γMurine IFN-γc
  • a Leader sequence from 19-kDa glycosylated membrane protein of human adenovirus C, serotype 2, (available from the National Center for Biotechnology Information (NCBI) under accession no. CAC67720, aa 1–18), which was previously used in the design of vaccination plasmids (24).

  • b Th sequence, from tetanus toxin (available from NCBI under accession no. AAK72964, aa 831–845), which was previously used in the design of vaccination plasmids (25).

  • c Sequence available from NCBI under accession no. NP_032363, aa 1–155.