The JI
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     
 


The Journal of Immunology, 2008, 180, 6094 -6106
Copyright © 2008 by The American Association of Immunologists, Inc.

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow Request Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Kiefer, K.
Right arrow Articles by Bosma, M. J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Kiefer, K.
Right arrow Articles by Bosma, M. J.
Right arrowPubmed/NCBI databases
*Substance via MeSH

Antigen Receptor Editing in Anti-DNA Transitional B Cells Deficient for Surface IgM1

Kerstin Kiefer2,*,{dagger}, Pamela B. Nakajima2,*, Jennifer Oshinsky*, Steven H. Seeholzer*, Marko Radic{ddagger}, Gayle C. Bosma* and Melvin J. Bosma3,*

* Fox Chase Cancer Center, Philadelphia, PA 19111; {dagger} Department of Microbiology and Immunology, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107; and {ddagger} University of Tennessee, College of Medicine, Department of Molecular Sciences, Memphis, TN 38163


    Abstract
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 
In response to encounter with self-Ag, autoreactive B cells may undergo secondary L chain gene rearrangement (receptor editing) and change the specificity of their Ag receptor. Knowing at what differentiative stage(s) developing B cells undergo receptor editing is important for understanding how self-reactive B cells are regulated. In this study, in mice with Ig transgenes coding for anti-self (DNA) Ab, we report dsDNA breaks indicative of ongoing secondary L chain rearrangement not only in bone marrow cells with a pre-B/B cell phenotype but also in immature/transitional splenic B cells with little or no surface IgM (sIgM–/low). L chain-edited transgenic B cells were detectable in spleen but not bone marrow and were still found to produce Ab specific for DNA (and apoptotic cells), albeit with lower affinity for DNA than the unedited transgenic Ab. We conclude that L chain editing in anti-DNA-transgenic B cells is not only ongoing in bone marrow but also in spleen. Indeed, transfer of sIgM–/low anti-DNA splenic B cells into SCID mice resulted in the appearance of a L chain editor (V{lambda}x) in the serum of engrafted recipients. Finally, we also report evidence for ongoing L chain editing in sIgMlow transitional splenic B cells of wild-type mice.


    Introduction
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 
Developing bone marrow (BM)4 B cells that are strongly autoreactive may avoid elimination by changing the specificity of their Ag receptor (1, 2, 3). This process is referred to as receptor editing and usually involves secondary L chain gene rearrangement and expression of a new or additional L chain (4, 5). L chain editing was first demonstrated in mice containing Ig transgenes (tgs) that code for Abs with anti-self specificity (1, 2, 3). Subsequent studies have indicated that L chain editing may occur frequently and help shape the Ab repertoire (6, 7).

L chain receptor editing appears to be initiated as soon as immature B cells encounter self-Ag. For example, in the anti-MHC class I-transgenic mouse model (8), developing B cells that encounter self-Ag show reduced expression of surface IgM (sIgM), elevated RAG expression, and secondary L chain gene rearrangement (1, 9, 10, 11). In the anti-hen egg lysozyme (HEL)/soluble HEL (sHEL)-transgenic mouse model (12), the level of IgM surface expression was shown to correlate inversely with the strength of signaling through the BCR, i.e., the stronger the self-Ag (sHEL) signal, the lower the abundance of sIgM (13). Moreover, cells with the lowest sIgM showed the highest level of secondary L chain rearrangement (13, 14). Even low surface expression of a non-self-reactive BCR has been reported to result in secondary L chain rearrangement (15). In a more recent study, Tze et al. (16) reported that interruption of basal signaling through the BCR results in apparent reversion of affected B cells to an earlier developmental stage and secondary L chain rearrangement. Reversion of immature B cells to an earlier stage during the course of normal B cell differentiation was actually suggested earlier by Mehr et al. (17) based on mathematical modeling of the kinetics of developing B cell subsets in BM.

The above findings have led to the suggestion that down-regulation of sIgM on immature B cells may directly trigger secondary L chain rearrangement (15, 16). Accordingly, one would predict that dsDNA breaks indicative of ongoing secondary L chain gene rearrangement would be present in sIgM–/low autoreactive B cells. Indeed, using a transgenic mouse model (56RV{kappa}8 mice) with tgs coding for anti-DNA Ab (4, 18), we demonstrate in this report that sIgM–/low anti-DNA B cells in BM and spleen (SPL) of 56RV{kappa}8 mice contain dsDNA breaks at their wild-type (wt) {kappa} and {lambda} L chain loci. Splenic sIgM–/low anti-DNA B cells with dsDNA breaks included those with an immature/transitional T3 cell surface phenotype (B220+CD23highCD93+sIgM–/lowsIgD+) (19) and a T3-like (T3') phenotype (B220+CD23–/lowCD93+sIgM–/lowsIgD+). T3/T3' splenic B cells were greatly overrepresented in 56RV{kappa}8 mice as these mice contained 3- to 5-fold more such cells than nontransgenic control mice. The observed dsDNA breaks in anti-DNA splenic B cells with a T3/T3' phenotype suggested that L chain editing is still ongoing outside of the BM relatively late in B cell differentiation. Consistent with such editing, we found that engraftment of SCID mice with T3/T3' splenic B cells from 56RV{kappa}8 mice along with T cells from mice lacking B cells (JH–/– mice) resulted in the appearance of a L chain editor (V{lambda}x) in the serum of engrafted recipients. Importantly, T3/T3' splenic B cells from nontransgenic wt mice were also found to contain dsDNA breaks indicative of ongoing L chain rearrangement. This finding is of particular interest because T3 splenic B cells from wt mice have been reported to represent anergic self-reactive B cells unable to give rise to mature B cells (20, 21).


    Materials and Methods
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 
Mice

C.B-17 scid/+ mice hemizygous for the site-directed transgenes, 3H9 or 3H9(56R) and V{kappa}8 (4, 22, 23), were produced by crossing C.B-17 scid/scid mice doubly homozygous for these tgs (e.g., 3H9/3H9, V{kappa}8/V{kappa}8, scid/scid mice) with C.B-17 wt mice. The resulting C.B-17 scid/+ mice, hemizygous for 3H9 or 3H9(56R) and V{kappa}8, are simply designated as 3H9V{kappa}8 and 56RV{kappa}8 mice, respectively. To produce mice homozygous for 56R and hemizygous for V{kappa}8 (56R/56R, V{kappa}8/+ mice), we crossed 56R/56R, V{kappa}8/V{kappa}8 wt mice with 56R/56R, scid/scid mice. Similarly, to produce mice hemizygous for 56R and homozygous for V{kappa}8 (56R/+, V{kappa}8/V{kappa}8 mice), we crossed 56R/56R, V{kappa}8/V{kappa}8, scid/scid mice with V{kappa}8/V{kappa}8 wt mice. C.B-17 scid/+ mice served as nontransgenic controls. Genotyping of transgenic mice was done by PCR as described previously (22, 23, 24). Investigators interested in obtaining mice homozygous for the tgs reported here should contact the Mutant Mouse Regional Resource Center (www.mmrrc.org). All of the mice used in this study, including BALB/c scid/scid (SCID mice), C57BL/6, (C57BL/6 x BALB/c)F1 mice, and C.B-17 mice with deleted JH loci (JH–/– mice) (25), were raised and maintained behind a barrier as specific pathogen-free mice in the Laboratory Animal Facility of the Fox Chase Cancer Center. Mice were used between 8 and 12 wk of age (unless otherwise stated) according to the protocols approved by the Animal Care and Use Committee of this institution.

B cell hybridomas

SPL cells from a 5-mo-old 56RV{kappa}8 mouse were stimulated with LPS (50 µg/ml) for 2 days and then fused with Sp2/0 cells (26) as described previously (27). Screening of culture supernatants by ELISA showed all hybridomas to produce IgM. The IgM protein in hybridoma supernatants was purified by precipitation in 60% saturated (NH4)2SO4 followed by size fractionation of the precipitated IgM using Amicon Ultra-15 Centrifugal Filter Units (Millipore). Purified hybridoma proteins were used for IgM allotyping, anti-dsDNA-binding assays and mass spectrometry. The anti-V{lambda}x-producing hybridoma, 10C5 (28) was generously provided by P.-A. Cazenave (Institute Pasteur, Paris, France). It was grown in a CELLine Bioreactor System (Integra Biosciences) and the Ab was purified using a Melon Gel IgG Purification Kit (Pierce) as directed by the manufacturer.

Flow cytometry

Cell suspensions of BM and SPL were prepared and stained in the manner previously described (29, 30). Cells were stained for CD43, CD45 (B220), IgM, IgMa, IgMb, IgDa, CD23, CD93, and V{lambda}x using combinations of the following reagents: fluorescein (FL)-anti-CD43 (S7), allophycocyanin-anti-B220 (RA3–6B2), FL-anti-IgDa (AMS9.1), FL-anti-IgM (331.12), biotin-anti-IgM (331.12), FL-anti-IgMa (RS3.1), biotin-anti-IgMb (AF6-78), biotin-anti-V{lambda}x (10C5), Cy7PE-anti-CD23 (B3B4), and PE-anti-CD93 (AA4.1). Biotin-conjugated reagents were visualized by a second-step incubation with QDot605-streptavidin (Invitrogen). Biotin-anti-IgMb (AF6-78), Cy7PE-anti-CD23, PE-anti-CD93, and FL-anti-IgDa were obtained from BD Pharmingen. All other Ab reagents were prepared in this laboratory. Analyses were performed with FACSVantageSE/Diva and LSRII flow cytometers (BD Biosciences) using FlowJo software (Tree Star). All cytometric dot plots are based on the analysis of 105 cells for the indicated gates. Forward and side scatter were set to exclude nonlymphoid cells. Propidium iodide staining was used to exclude dead cells.

Induction of apoptosis and confocal microscopy

Apoptosis of Jurkat cells was induced for 4 h by the addition of 2.0 µM camptothecin (Sigma-Aldrich). At the end of the incubation period, 5 x 105 cells were collected and used in each binding reaction. Cells were washed in HBSS (Mediatech) with 3 mM CaCl2 and fixed in freshly prepared, ice-cold 6% paraformaldehyde (Electron Microscopy Sciences) in the same buffer for 15 min. Fixed cells were washed in HBSS and 3 mM CaCl2, pelleted at 1600 rpm for 5 min. and blocked by resuspension in wash buffer (HBSS containing 3 mM CaCl2, 3% FBS, and 0.02% azide) for 5 min. Cells were pelleted again and resuspended in 20 µg/ml of the primary Ab in wash buffer. Following a 30-min incubation with the primary Ab, cells were washed in wash buffer, pelleted as above, and incubated in a mixture of Alexa Fluor 647 goat anti-mouse IgM (µ-chain- specific) antisera (1/100 dilution), SYTOX Orange DNA stain (1/10,000 dilution), and Alexa Fluor 488/annexin V (1/70 dilution). All secondary reagents and stains were obtained from Invitrogen. Following incubation on ice for 20 min., cells were washed and resuspended in wash buffer containing 50% glycerol before mounting on 24-well, Teflon-printed microscope slides (Electron Microscopy Sciences).

Samples were viewed on a Zeiss LSM 510 laser scanning microscope by using a x40 Plan-Apochromat oil-immersion lens and excitation at 488, 543, and 633 nm. Detection channels recorded fluorescence emission above 650 nm for Alexa Fluor 647 (displayed as red for consistency with our previous experiments), between 560 and 615 nm for SYTOX Orange (displayed as blue), and between 505 and 530 nm for Alexa Fluor 488 (displayed as green). Stacks of images were collected using between 20 and 30 optical sections taken at intervals of between 0.4 and 0.8 µm.

Serological assays

Hybridoma supernatants were screened by ELISA for the expression of IgM, IgMa, IgMb, Ig{kappa}, Ig{lambda}1 (from BD Pharmingen), and V{lambda}x using purified mAbs. Assays were performed as described earlier (24) using solutions, buffers, and standards prescribed by BD Pharmingen. Hybridomas secreting IgM molecules that reacted with both anti-IgMa (RS 3.1) and IgMb (AF6-78) were detected using a sandwich ELISA protocol. The protocol involved coating plates with anti-IgMa to allow the binding of IgMa; this was followed by the addition of biotinylated anti-IgMb. To detect IgM anti-dsDNA Ab, we used the ELISA protocol previously described (24). To assay for serum IgV{lambda}x, plates were coated with purified anti-V{lambda}x (10C5) followed by the addition of 5-fold diluted sera and biotinylated anti-V{lambda}x. Purified IgM from the hybridoma C6 (see Fig. 9A) was used as the standard for quantitation of serum V{lambda}x.


Figure 9
View larger version (48K):
[in this window]
[in a new window]

 
FIGURE 9. Purified IgMa from 56RV{kappa}8 hybridomas binds to dsDNA and apoptotic cells. A, ELISA results for relative binding of IgM as a function of the concentration of IgM added to wells coated with avidin/biotinylated dsDNA. Top panel shows binding curves for unedited 56RV{kappa}8 Ab of four hybridomas (A1–4). Unfilled circle and square symbols close to the abscissa correspond to purified IgM preparations from two IgMb-expressing hybridomas (from group D in Table II). Center panel shows binding curves for 56RV{kappa}21D Ab of six hybridomas (B1–2 and B4–7). Bottom panel shows binding curves for 56RV{lambda}x Ab of six hybridomas (C1–4 and C6–7). B, Jurkat cells treated (apoptotic) or untreated (live) with camptothecin were fixed and incubated with nonspecific IgM{lambda} (11E10) or IgM proteins consisting of 56RV{kappa}8 (A4, top row), 56RV{kappa}21D (B1 and B7, middle rows), or 56RV{lambda}x (C2 and C3, bottom rows). Bound Ab was detected with anti-IgM secondary reagent (displayed in red). DNA was visualized by binding of Sytox Orange (displayed in blue), whereas annexin V marked the presence of phosphatidylserine (green). These images are individual cross-sections taken from complete three-dimensional serial sections of each apoptotic cell.

 
Genomic PCR

DNA was prepared from B cell hybridomas: Briefly, cells grown in 24-well plates were harvested by spinning the plates at 1200 rpm for 3 min and washing the cells in 500 µl of PBS (pH 7.4). Washed cells were resuspended in 300 µl of lysis buffer (31) and incubated overnight at 56°C. The next day, lysed cell samples were boiled for 15 min and stored at 4°C. PCR assays were done in a 50-µl volume containing 2 µl of template DNA and 1 U of Platinum TaqDNA polymerase (Invitrogen). For PCR amplification of the 56R tgs, we used the protocol described by Erikson et al. (32) and primers specific for the 56R leader (5'-CTGTCAGGAACTGCAGGTAAGG) and 56R CDR3 region (5'-CATAACATAGGAATATTTACTCCTCGC). To amplify recombining sequence (RS)-mediated rearrangements at the {kappa} locus. a combination of primers was used as described by Retter and Nemazee (6) including primers specific for regions 3' of the RS element (MB 619; 5'-ACATGGAAGTTTTCCCGGGAGAATATG) and 5' of the IRS1 element (5'-CAACCTCTTCTTTACAACTGGGTGACC) and primers specific for the V{kappa} framework region 3 (5'-GGCTGCAGSTTCAGTTGGCAGTGGRTCWGGRAC) (31) and the V{kappa}8 leader (GGTACCTGTGGGGACATTGTG) (32). To score for DH to JH rearrangement at the wt H chain allele, we used a degenerate primer (5'-GGAATTCGMTTTTTGTSAAGGGATCTACTACTGTG) for DH (33) and primers 3' of JH2 (5'-GGCTCCCAATGACCCTTTCTGA) or JH4 (5'-CTGTCCTAAAGGCTCTGAGATCC). Unrearranged wt H chain alleles were scored by retention of germline sequence upstream of JH1 using the forward (5' JH1) and reverse (3' JH1) primers, 5'-GCCAAGGACTTACCAAGAGG and 5'-GATGCAGGACTCACCTGACC (22), respectively.

Ligation-mediated PCR (LM-PCR)

Genomic DNA samples for LM-PCR were prepared from cells embedded in agarose as described previously (34). Linker ligation was performed with one-quarter of an agarose block (35). Broken molecules with recombination signal ends were amplified from linker-ligated DNA using one-tenth of the linker ligation reaction and the linker primer (5'-GCTATGTACTACCCGGGAATTCGTG) and a locus-specific primer. J{kappa} signal ends were amplified with the 5' J{kappa}-specific primer (5'-AGTGCCACTAACTGCTGAGCCACCT) and V{lambda}x signal ends were amplified with a 3' V{lambda}x-specific primer (MB719; 5'-AACATTGTGGCTGTCTCAGTGGCTCA). J{kappa} coding ends were amplified with a 3' J{kappa}1-specific primer (5'-TCTCCAGAGAACATGTCTAGCC) using DNA pretreated with T4 DNA polymerase. RS{kappa}-associated breaks were amplified with a 5' RS{kappa}-specific primer (MB615; 5'-CAGAAATGAAGGCAGACTCTCTCTAAC). The PCR conditions were 35 of 20 s at 95°C and 30 s at 63°C for DNA breaks at J{kappa} or 65°C for DNA breaks at V{lambda}x and 30 s at 72°C, with a final 5-min extension at 72°C (see Figs. 3B and 4B). To control for the amount of DNA in each linker-ligated sample, the β2-microglobulin (β2m) gene was amplified for 25 cycles using a 5' (5'-GAATGGGAAGCCGAACATACTGAACTG) and 3' (5'-TGCTGATCACATGTCTCGATCC) primers with a cycle profile of 30 s at 95°C, 30 s at 61°C, and 45 s at 72°C.


Figure 3
View larger version (31K):
[in this window]
[in a new window]

 
FIGURE 3. Analysis of 56RV{kappa}8 B cell subsets for RAG expression and dsDNA breaks at J{kappa}, the RS element downstream of C{kappa} and V{lambda}x. A, Bar graphs indicate the level of RAG1 expression (as determined by real-time quantitative RT-PCR) in sorted B cell subsets of 56RV{kappa}8 BM and SPL relative to that in pro-B cell fraction of wt BM, which was assigned a value of 1.0. Error bars indicate the SEM for four independent experiments. B, Genomic DNA from ~7 x 104 sorted B cells was analyzed by LM-PCR for J{kappa}1, J{kappa}2, J{kappa}3, RS, and V{lambda}x recombination intermediates. Sorted cells included those from BM and SPL of 56RV{kappa}8 mice and from control BM of 56R/+, V{kappa}8/V{kappa}8 mice (BM V{kappa}8/V{kappa}8). Recombination intermediates with J{kappa} signal, J{kappa} coding, RS, and V{lambda}x signal ends are indicated in brackets I-IV, respectively. DNA from liver of RAG1–/– mice served as a negative control and β2m as a control for DNA loading. imm. Immature; mat, mature.

 

Figure 4
View larger version (69K):
[in this window]
[in a new window]

 
FIGURE 4. Comparative analysis of T3 and T3' splenic B cells in 56RV{kappa}8 and C57BL/6 mice. A, Flow cytometric profiles delineating transitional splenic B cell populations in 56RV{kappa}8 and C57BL/6 mice. Gates were set as in Fig. 2. Numbers outside and within the boxed areas and above the horizontal bars correspond to the percentage of cells with the indicated phenotype. B, Genomic DNA from ~7 x 104 sorted T3 and T3' (and T1 and T2) splenic B cells was analyzed by LM-PCR for dsDNA breaks at J{kappa} elements. DNA from BM of 56RV{kappa}8 RAG1–/– mice and from sorted pre-B cells of 56RV{kappa}8 mice served as a negative and positive control, respectively. β2m served as a control for DNA loading.

 
Southern blot and DNA sequence analysis

LM-PCR products were subjected to agarose gel electrophoresis, transferred to nylon membranes, and hybridized to random-primed 32P-labeled probes generated from gel-purified DNA fragments in the manner described earlier (35). The J{kappa} probe was a 1.7-kb fragment from pJ{kappa} and spans the J{kappa} region (36). The V{lambda}x probe, containing ~500 bp of 3' flanking sequence and confirmed by DNA sequence analysis, was a 745-bp fragment amplified from genomic liver DNA with oligonucleotides 5'-ACCTTGAGTAGTCAGCACAG (specific for the V{lambda}x exon) and MB719. The RS{kappa} probe was a 398-bp fragment amplified from genomic liver DNA with oligonucleotides MB615 and MB619. The β2m probe was made using the β2m- specific primers indicated above and gel purified. Clones for nucleotide sequence analysis were produced using the TOPO TA cloning kit (Invitrogen) and underwent plasmid recovery using a Perfectprep plasmid mini kit (Brinkman Instruments). Plasmids were submitted for cycle sequencing using the Applied Biosystems Prism dye terminator reaction kit and a model 3100 genetic analyzer (Applied Biosystems).

Quantitative RT-PCR assay

Total RNA was prepared using a Micro RNAeasy kit according to the manufacturer’s protocol (Qiagen). cDNA was synthesized by adding 2 µl of oligo(dT)18 primer (50 µM; Ambion) to 10 µl of total RNA, heating at 70°C for 3 min, cooling on ice, adding 2 µl of reverse transcriptase (RT) buffer (Ambion), 1 µl of dNTPs (each dNTP at 10 mM; Invitrogen), 0.6 µl of Superase-in (20 U/µl; Ambion), and 1 µl of ArrayScript RT (200 U/µl; Ambion), and then incubating at 42°C for 1 h. Gene expression was quantitated by real-time PCR. Analyses were performed in triplicate in 25-µl volumes using an Applied Biosystems I7500 thermal cycler. The cDNA was typically diluted 1/3. All probes were purchased from Applied Biosystems. Applied Biosystems software was used to quantify/calculate cycle threshold values and to determine relative gene expression levels using β-actin values for standardization.

SMART 5' RACE assay

Total RNA from 1 x 106 hybridoma cells was obtained using RNAeasy (Qiagen) and mRNA was isolated using Oligotex (Qiagen) according to the manufacturer’s instructions. Full-length cDNA was synthesized using a modified version of the SMART (switching mechanism at 5' end of RNA transcript) technique (37) with one-tenth of the mRNA, PowerScript RT (BD Biosciences), 1.2 mM SMART oligonucleotide (5'-d(AAGCAGTGGTAACAACGCAGAGTAdCGC)ggg; Biosearch Technologies), 1 mM dNTP mixture (Invitrogen), and 5 µM oligo(dT) primer (Ambion) in a 10-µl reaction volume. The Ig cDNA was amplified via 5' RACE-anchored RT-PCR using an Advantage 2 PCR kit (BD Clontech), 5' Universal primer mix (40 nM 5'-CTAATACGACTCACTATAGGGCAAGCAGTGGTAAACAACGCAGAGT and 200 nM 5'-CTAATACGACTCACTATAGGGC) along with a reverse primer complementary to the constant region of the µ (5'-ATGCTCTTGGGAGACAGCAAGACCTGCG)- or {kappa} (5'-CTCGTCCTTGGTCAACGTGAGGGTGCTG)- chain. The 5' RACE RT-PCR conditions were: 95°C, 30 s, 5 cycles of 95°C for 5 s and 72°C for 1 min, then 5 cycles of 95°C for 5 s, 70°C for 10 s, 72 °C for 1 min, and finally 25 cycles of 95°C for 5 s, 68°C for 10 s, and 72°C for 1 min with a final extension time of 5 min at 72°C.

Mass spectrometry

Purified IgM from supernatants of B cell hybridomas was reduced and subjected to 10% SDS-PAGE. The gels were stained with colloidal Coomassie blue and the L chains were excised and digested with trypsin after destaining, reduction, and alkylation (38, 39). Recovered peptides were prepared for MALDI-TOF mass spectrometry by mixing 1 µl of the peptide mixture with 2 µl of 30 µg/ml {alpha}-cyano-4-hydroxycinnamic acid and 0.4% trifluoroacetic acid in a 2:1 ethanol:acetone mixture and allowing the droplet to dry on the MALDI sample plate (40). In some cases, the {alpha}-cyano-4-hydroxycinnamic acid-affinity sample preparation was used to improve sensitivity (41). Peptide mass maps were obtained using a Bruker Daltonics Reflex IV MALDI-TOF mass spectrometer operated in positive ion reflectron mode. Proteins were identified from the peptide mass maps using Mascot (Matrix Science) (42) to search the protein sequence databases. A special protein database comprised of all know mouse L chain V, J, and C regions was constructed using the ImMunoGeneTics (IMGT) database (http://imgt.cines.fr/textes/IMGTrepertoire/Proteins/#1).


    Results
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 
Ig-transgenic mouse model for anti-DNA B cells

In 3H9(56R)/+, V{kappa}8/+-transgenic mice, the model system used in this study, the J regions of one H and L ({kappa}) chain allele have been replaced with VDJH and VJ{kappa} coding sequences of the 3H9(56R) and V{kappa}8 tgs (4, 23, 43). H chains coded by 3H9(56R) differ from those coded by 3H9 by one amino acid; the 3H9 chain contains aspartate at position 56, whereas 3H9(56R) has arginine at this position (4). Together, 3H9(56R) and V{kappa}8 code for a relatively high-affinity anti-DNA Ab, whereas 3H9 and V{kappa}8 code for a low-affinity anti-DNA Ab (18). In this study, we used H/L chain-transgenic C.B-17 scid/+ mice hemizygous for the above tgs; i.e., 3H9(56R)/+, V{kappa}8/+, scid/+ and 3H9/+, V{kappa}8/+, scid/+ mice. The mice are simply designated with the prefix 56RV{kappa}8 and 3H9V{kappa}8, respectively. C.B-17 scid/+ mice were used as the nontransgenic control; the scid mutation is recessive and these mice have a wt phenotype (44, 45). In some experiments, we included H/L chain-transgenic C.B-17 scid/+ mice homozygous for 56R (56R/56R, V{kappa}8/+, scid/+ mice) or V{kappa}8 (56R/+, V{kappa}8/V{kappa}8, scid/+ mice).

Skewed representation of B cell subsets in 56RV{kappa}8 mice

The primary question posed in this study was: when and where do developing anti-DNA B cells in 56RV{kappa}8 mice undergo L chain receptor editing? To address this question, it was of interest to know whether the normal representation of pro-B, pre-B, and immature/transitional B cell subsets in BM and SPL is markedly altered in 56RV{kappa}8 mice. As shown in Figs. 1 and 2, there were marked differences in the representation of these B cell subsets in 56RV{kappa}8 mice vs 3H9V{kappa}8 and nontransgenic control mice (wt mice). Such differences were most striking in the SPL. For example, in 56RV{kappa}8 mice, ~10% of the sIgM gated lymphocytes (arrow in Fig. 1) stained positive for B220 (B220+CD43sIgM cells). In contrast, in wt and 3H9V{kappa}8 mice, the corresponding B220+CD43sIgM cell population represented ≤0.5% of sIgM gated lymphocytes. Using the additional B cell lineage markers, CD23 (46), CD93 (47), and surface IgD (sIgD), we found most B220+sIgM–/low cells in the SPL of 56RV{kappa}8 mice to display a T3 or T3-like immature/transitional phenotype (Fig. 2). Transitional splenic B cells can be defined as T1, T2, or T3 according to their relative surface expression of IgM, IgD, CD21, CD23, CD24, and CD93 (19, 47, 48, 49). We used the markers B220, CD23, CD93, sIgM, and sIgD to delineate T1, T2, and T3 splenic B cells as designated by Allman et al. (19). The gates used to define B220+CD93+ transitional B cells in the SPL of 3H9V{kappa}8, 56RV{kappa}8, 56RV{kappa}8 RAG1–/– and wt mice are shown in Fig. 2, A and B. The CD93 staining of splenic B220+ cells (horizontal bar in Fig. 2B) in wt and transgenic mice was less uniform and intense than that of pre-B cells from wt BM (denoted by the dashed histogram).


Figure 1
View larger version (63K):
[in this window]
[in a new window]

 
FIGURE 1. Flow cytometric profiles illustrating differences in the representation of B cell subsets in BM and SPL of 56RV{kappa}8 compared with 3H9V{kappa}8 and wt mice. The percentage of IgM gated lymphocytes displaying a pro-B (B220+CD43+IgM) or pre-B (B220+CD43IgM) cell surface phenotype is denoted within the boxed areas of the B220 vs CD43 dot plots. The percentage of lymphocyte gated cells displaying a B220+sIgM–/low or B220+sIgM+ cell surface phenotype in BM and SPL is denoted within the boxed areas of the B220 vs IgM dot plots. The profiles shown here (and in Figs. 2, 4, and 5) are representative of several independent experiments; in every experiment, at least two animals of each genotype were analyzed.

 

Figure 2
View larger version (50K):
[in this window]
[in a new window]

 
FIGURE 2. Flow cytometric profiles delineating transitional splenic B cells in RAG1–/–, wt, 3H9V{kappa}8, and 56RV{kappa}8 mice. A, CD93 vs B220 staining of lymphocyte gated cells. B, Histograms of CD93 staining for B220+ gated cells in mice with the indicated genotypes; the dashed histograms correspond to CD93 staining of pre-B cells from wt BM. C, Upper panels, sIgM vs CD23 staining for B220+CD93+ gated cells show representation of T1, T2, T3, and T3' splenic B cells. Lower panels, Histograms of sIgDa staining for T3 and T3' splenic cells from 56RV{kappa}8 mice are compared with the histogram for T2 splenic cells from 3H9V{kappa}8 mice. SPL cells from C.B-17 scid/+ mice (IgDb) served as the negative control for IgDa staining (dashed line). No sIgDa was detectable on BM cells with a pre-B or immature B cell phenotype (data not shown). Numbers above the horizontal bars in B and within the boxed areas in A and C correspond to the percentage of cells with the indicated phenotype in individual mice.

 
The majority of B220+CD93+ splenic B cells in 56RV{kappa}8 mice displayed a T3 (CD23highIgM–/lowsIgD+) or T3-like (CD23–/lowIgM–/lowsIgD+) transitional phenotype (Fig. 2C). Cells displaying the latter phenotype will be simply referred to as T3' cells, although it remains to be determined whether this novel cell population corresponds to an additional subset of nondividing transitional cells. Both T3 and T3' cells were RAG active (Fig. 3A) and, consistent with the phenotype of T3 cells (19), were also CD21+ and CD24+ (our unpublished results in collaboration with R. Hardy). Note that sIgD, unlike sIgM, showed little down-regulation in T3 and T3' splenic B cells of 56RV{kappa}8 mice and was displayed at a level only slightly less than that of sIgD on T2 cells of 3H9V{kappa}8 mice (see histograms in lower row of Fig. 2C). This finding is similar to that reported earlier by Goodnow et al. (12) in the anti-HEL/sHEL-transgenic mouse model in which anti-HEL splenic B cells showed persisting sIgD despite markedly reduced levels of sIgM. Finally, it should be noted that T1/T2 cells were underrepresented and T3/T3' cells were overrepresented in 56RV{kappa}8 SPL compared with 3H9V{kappa}8 and wt controls (Fig. 2C). The mean percentages (±SEM) of T1, T2, T3, and T3' splenic B cells for all mice analyzed, including C57BL/6 wt mice, are given in Table I. As discussed later, one possible explanation of these results is that expression of the strongly self-reactive 56RV{kappa}8 receptor may cause most arising T1 and T2 B cells in C.B-17 mice to down-regulate their sIgM and display a T3' and T3 cell surface phenotype.


View this table:
[in this window]
[in a new window]

 
Table I. Representation of transitional splenic B cell subsets in individual 56RV{kappa}8, 3H9V{kappa}8, C.B-17 scid/+, and C57BL/6 mice

 
Secondary L chain rearrangement in 56RV{kappa}8 mice is ongoing in BM and SPL

To test whether L chain receptor editing was ongoing in both BM and SPL of 56RV{kappa}8 mice, we sorted pro-B (B220+CD43+IgM), pre-B (B220+CD43IgM), and B (B220+IgMlow) cells from BM and immature/transitional T3 (B220+CD23highCD93+ IgM–/low), T3' (B220+CD23–/lowCD93+IgM–/low) and B (B220+IgM+) cells from SPL. These B cell subsets were first compared for RAG expression relative to that in sorted pro-B cells from wt mice using real-time quantitative RT-PCR. Since similar results were obtained for both RAG1 and RAG2 expression, we show the results for RAG1 only in Fig. 3A. Strikingly, RAG expression in B lineage cells of 56RV{kappa}8 BM was strongly up-regulated in the pre-B but not the pro-B subset. The basis for relatively low RAG expression in 56RV{kappa}8 pro-B cells is not clear. However, because these cells contain a prerearranged H chain gene, there would be no need for strong up-regulated RAG expression at the pro-B cell stage. RAG expression in B cells of 56RV{kappa}8 BM was ~7% of the level of that in the wt pro-B cells. In the SPL, RAG expression was strongly up-regulated in T3' B cells and ~8-fold higher than in T3 B cells. In splenic B cells of 56RV{kappa}8 mice, RAG expression was ≤1% of that in wt BM pro-B cells.

We next tested sorted B cell subsets from 56RV{kappa}8 mice for ongoing secondary L chain rearrangement as indicated by the presence of dsDNA breaks at the wt {kappa} allele and the V{lambda}x gene. V{lambda}x is a known editor of 56R anti-dsDNA Ab (18, 50). LM-PCR (51, 52) was used to detect dsDNA breaks at the borders of J{kappa} and V{lambda}x coding elements and their associated recombination signal sequences. RAG-mediated cleavage of DNA results in two species of broken molecules (recombination intermediates): those with signal ends and those with coding ends (reviewed in Ref. 53). In 56RV{kappa}8 BM, J{kappa} signal ends appeared most abundant in the pre-B and B cell fractions; the pro-B cell fraction contained relatively few J{kappa} signal ends (Fig. 3B, bracket I). Similar results were obtained for J{kappa} coding ends (Fig. 3B, bracket II). Note, however, that coding ends were not detectable in the pro-B cell fraction, a finding that may in part reflect the shorter half-life of coding vs signal ends (54). J{kappa} signal and coding ends were also detectable in T3 and T3' splenic B cells (and the less stringently sorted cell fraction of splenic B220+sIgM cells). Coding ends are rapidly joined during V(D)J recombination (55, 56). Thus, the presence of coding ends in RAG-active T3/T3' splenic B cells is taken as evidence that the observed recombination intermediates were directly generated in these cell populations as opposed to being carried over from an earlier stage of differentiating B cells.

As expected, no J{kappa} signal or coding ends were detected in the pre-B cell subset from 56R/+, V{kappa}8/V{kappa}8 mice (see BM V{kappa}8/V{kappa}8 lane in Fig. 3B, brackets I and II). In these mice, the J{kappa} region of both alleles contains the inserted V{kappa}8J{kappa}5 coding segment (23); thus, there is no J{kappa} substrate available for RAG targeting. Nonetheless, the {kappa} locus in 56R/+, V{kappa}8/V{kappa}8 mice was clearly targeted by the recombinase machinery as indicated by dsDNA breaks at the RS downstream of C{kappa} (57, 58) (Fig. 3B, bracket III). dsDNA breaks were not limited to the {kappa} locus because we also found dsDNA breaks at the V{lambda}x gene in BM pre-B/B cells and T3/T3' splenic B cells (Fig. 3B, bracket IV). Sequencing of V{lambda}x products amplified by LM-PCR confirmed that they corresponded to DNA molecules cleaved at the V{lambda}x coding/signal border (our unpublished data). From the results of Fig. 3 it is clear that, in 56RV{kappa}8 mice, secondary L chain rearrangement is not only ongoing in BM cells with a pre-B/B cell phenotype, but also outside of the BM in splenic B cells with a T3/T3' phenotype.

To test for possible ongoing L chain rearrangement in T3/T3' splenic B cells of nontransgenic wt mice, we sorted these cell populations from the SPL of C57BL/6 mice and tested for dsDNA breaks at the signal/coding border of J{kappa} elements (Fig. 4). We chose C57BL/6 mice because T3 splenic B cells in these mice have been reported to represent mainly anergic self-reactive B cells (20, 21). As indicated in Fig. 4A, T3/T3' splenic B cells from C57BL/6 mice were less abundant and showed less down-regulation of sIgM than from 56RV{kappa}8 mice. Following three independent sorts for T3/T3' splenic B cells from C57BL/6 mice, we obtained sufficient material to assay for J{kappa} recombination intermediates. Fig. 4B shows that J{kappa} signal ends were present in the T3/T3' splenic B cell populations of C57BL/6 mice at a level comparable to that seen in the 56RV{kappa}8 controls. We interpret these results to indicate that the T3/T3' splenic B cell populations in wt mice, as in 56RVk8 mice, contain B cells undergoing L chain editing. As discussed later, some of these B cells may succeed in editing their Ag receptor and give rise to mature B cells. Splenic B cells with a T1 and T2 phenotype were also sorted from C57BL/6 mice and found to contain J{kappa} signal ends (Fig. 4B), consistent with a recent report of J{kappa} signal ends in the T1 and T2 splenic B cells of nontransgenic C.B-17 mice (59). Thus, with respect to the presence of J{kappa} recombination intermediates, the splenic B cell populations T1 and T2 appear similar to T3 and T3'. As functionally immature B cells, members of the T1-T3 subsets also appear similar with respect to their unresponsiveness to BCR stimulation and rapid turnover (19).

Detection of L chain-edited B cells in SPL but not BM of 56RV{kappa}8 mice

Consistent with the detection of dsDNA breaks at the wt {kappa} allele and V{lambda}x gene, two distinct populations of L chain-edited B cells were readily detectable in the SPL but not the BM of 56RV{kappa}8 mice. One population expressed V{lambda}x (see diagonal profile marked with an arrow in Fig. 5A) and represented ~6% of the B220+ gated cells and ~14% of all IgMa-expressing splenic B cells. Note that ~3% of V{lambda}x-expressing cells displayed little or no sIgMa; these cells were found to be sIgDhigh for the IgDa allotype (our unpublished data). V{lambda}x-expressing B cells were not detectable in 3H9V{kappa}8 mice or in wt mice. Thus, the development of V{lambda}x-expressing B cells in 56RV{kappa}8 mice is clearly dependent on the 56R tg.


Figure 5
View larger version (41K):
[in this window]
[in a new window]

 
FIGURE 5. Detection of V{lambda}x-edited B cells and serum V{lambda}x. A, Profiles of IgMa (the 56R tg allotype) vs V{lambda}x for B220+ gated cells. BM and SPL cells from individual mice of each genotype were analyzed for the indicated markers. The arrow points to doubly stained (IgMa+/V{lambda}x+) splenic B cells. The numbers in the upper right of each panel indicate the percentage of cells in each quadrant. The mean percentage (±SEM) of IgMa+/V{lambda}x+ splenic cells in nine 56RV{kappa}8 mice was 6.5 ± 1.7. B, Levels of serum V{lambda}x. The filled diamonds and triangles in the two panels on the left correspond to serum V{lambda}x concentrations in individual 3H9V{kappa}8 and 56RV{kappa}8 mice, respectively, at 10–12 wk of age. The mean (±SEM) concentration of serum V{lambda}x in 56RV{kappa}8 mice was 0.672 (±0.29) µg/ml. The circles in the two panels on the right correspond to V{lambda}x serum concentrations in BALB/c SCID mice that received an i.v. injection of 106 sorted T3' cells ({circ}) or 2 x 106 T3 cells (•) admixed with BM (2 x 106 cells) and thymus (3 x 106 cells) from C.B-17 JH–/– mice. Control BALB/c SCID mice (x) received C.B-17 JH–/– donor cells only. The mean concentration (±SEM) of serum V{lambda}x in the seven SCID recipients with detectable V{lambda}x was 1.10 (±1.41) and 2.11 (±3.27) µg/ml at 7 and 9 wk after cell transfer, respectively.

 
Evidence that V{lambda}x-expressing B cells can differentiate into V{lambda}x-producing plasma cells is shown in Fig. 5B. 56RV{kappa}8 mice contained very low, but detectable levels of serum V{lambda}x (0.42–1.42 µg/ml), whereas most 3H9V{kappa}8 mice lacked detectable serum V{lambda}x (≤0.02 µg/ml; Fig. 5B). No serum V{lambda}x was detectable in C.B-17 scid/+ mice, the nontransgenic control (our unpublished results), consistent with previous reports of little or no detectable V{lambda}x protein in normal mice (28, 50). To test whether the T3 and T3' subsets contained cells able to differentiate into V{lambda}x-producing plasma cells, we transferred sorted T3 and T3' cells into SCID recipients in the manner previously described (24). Recipients also received a mixture of BM and thymus cells from C.B-17 JH–/– mice to provide a source of T cell help for any successfully V{lambda}x-edited B cells that might arise from the T3 and T3' cell populations. Serum V{lambda}x was detectable 5 wk after cell transfer and, as shown in Fig. 5B, all but one recipient was found to contain low levels of serum V{lambda}x (0.15–9.8 µg/ml) at 7 and 9 wk after cell transfer. No serum V{lambda}x was found in the SCID controls engrafted with C.B-17 JH–/– donor cells only. These results indicate that the T3 and T3' splenic B cell populations contain cells capable of giving rise to edited V{lambda}x-producing B cells.

The SPL of 56RV{kappa}8 mice also contained a V{kappa}-edited cell population that was evident from an unexpected cross-reaction with the AF6-78 monoclonal anti-IgMb reagent (Fig. 6). In the course of testing for possible H chain editing (i.e., expression of the wt allotype (IgHb) instead of the tg allotype (IgHa)), we found ~14% of B220+ gated SPL cells in 56RV{kappa}8 mice (designated as 56R/+, V{kappa}8/+ mice in Fig. 6) to stain positive for both sIgMa and sIgMb; 35–43% of the remaining B220+ gated cells stained for sIgMa only and 8–9% stained for sIgMb only. The doubly stained cells represented 25–30% of cells expressing the sIgMa allotype; B cells staining positive for both sIgMa and sIgMb or for sIgMb alone were not detectable in 56RV{kappa}8 BM or in SPL of 3H9V{kappa}8 mice. Further analysis revealed the presence of the doubly stained B cell population in mice homozygous for 56R and hemizygous for V{kappa}8 (56R/56R, V{kappa}8/+ mice). The genetic makeup of these mice would preclude any ability to express the IgMb allotype. Strikingly, no doubly stained B cells were detected in mice genetically competent to express both IgMa and IgMb allotypes, i.e., in mice hemizygous for 56R and homozygous for V{kappa}8 (56R/+, V{kappa}8/V{kappa}8 mice). From these results, we inferred that B cells doubly stained for sIgMa and sIgMb express an IgMa molecule with a L chain editor coded by the wt {kappa} allele and that expression of this editor makes such molecules cross-reactive with the AF6-78 anti-IgMb reagent. Validation of this inference and identification of the L chain editor as V{kappa}21D is given in the next section. It is important to note here that V{kappa}21D appears not to be used in 3H9V{kappa}8 mice even though it has been shown to edit (veto) the ability of 3H9-coded H chains to bind dsDNA (4). Splenic B cells doubly stained for sIgMa and sIgMb were not detectable in 3H9V{kappa}8 mice (Fig. 6). We interpret these results and those of Fig. 5 to reflect little or no L chain editing in 3H9V{kappa}8 mice, consistent with an earlier report by Casellas et al. (7) showing 3H9V{kappa}8 mice to lack {kappa}- and {lambda}-edited B cells.


Figure 6
View larger version (42K):
[in this window]
[in a new window]

 
FIGURE 6. Evidence for a specific V{kappa}-edited B cell population in the SPL of 56RV{kappa}8 mice. Profiles of IgMa vs IgMb for B220+ gated cells of (C57BL/6 x BALB/c)F1; 56R/+, V{kappa}8/+; 56R/56R, V{kappa}8/+; 56R/+, V{kappa}8/V{kappa}8 and 3H9/+, V{kappa}8/+ mice. BM and SPL cells from individual mice of each genotype were analyzed for the indicated markers. The arrows point to splenic B cells that were doubly stained for IgMa and IgMb. The numbers in the upper right of each panel indicate the percentage of cells in each quadrant. The mean percentage (±SEM) of doubly stained splenic cells in six 56R/+, V{kappa}8/+ mice was 12.2 (±2.5).

 
Analysis of L chain gene rearrangements in 56RV{kappa}8 splenic B cell hybridomas

To test for the representation and identity of L chain editors in individual B cells, we fused SPL cells from a single 56RV{kappa}8 mouse with the SP2 cell line (26). Twenty-six hybridomas were obtained and all secreted IgM (Table II). Hybridoma culture supernatants were screened by ELISA for expression of the H chain allotype of the 56R (IgMa) and wt (IgMb) alleles; 13 typed positive for IgMa (groups A and C) and 6 for IgMb (group D). Seven hybridomas typed positive with both anti-IgMa and anti-IgMb (group B). Purified IgM from culture supernatants was analyzed by ELISA to confirm the cross-reactivity of secreted IgM molecules recognized by both anti-IgMa and anti-IgMb (results shown in Table II). Extensive analysis of the hybridomas in group B showed they all retained an unaltered 56R tg (see B1–7 in Fig. 8B) and lacked a productive VDJ rearrangement at their wt H chain allele (our unpublished data). Thus, they could not have actually produced IgMb; instead, they appeared to produce IgMa molecules that cross-reacted with the anti-IgMb reagent as was also inferred for splenic B cells doubly stained for IgMa and IgMb in Fig. 6.


View this table:
[in this window]
[in a new window]

 
Table II. IgM allotyping of B cell hybridomas from 56RV{kappa}8 mouse; demonstration of IgMa molecules cross-reactive with a monoclonal anti-IgMb (AF6-78)a

 

Figure 8
View larger version (38K):
[in this window]
[in a new window]

 
FIGURE 8. B cell hybridomas expressing V{kappa}21D- and V{lambda}x-edited anti-dsDNA Abs represent distinct B cell clones. A, DNA sequences of DJH junctions of rearranged wt H chain alleles in hybridomas B1–7 and C1–7. In two hybridomas, the wt H chain locus was in germline configuration; all other hybridomas showed a rearranged wt allele. The hybridomas, B5 and C4, each contained two clones, designated B5a and B5b and C4a and C4b. B, Amino acid sequence for VH residues 40–80 of the original 56R tg and for the corresponding residues in the 56R tg of hybridomas B1–7 and C1–7. Amino acid sequences were deduced from the nucleotide sequence of 56R cDNA from each hybridoma (see Materials and Methods for details).

 
All 20 hybridomas expressing IgMa were screened for expression of V{kappa}8 and the two major L chain editors of anti-dsDNA Ab: V{lambda}x and V{kappa}21D (4, 18, 50). Screening was done by mass spectrometric analysis of the L chains in purified IgM molecules from each hybridoma. Distinguishing mass spectra "signature" peptides for V{kappa}8, V{kappa}21D. and V{lambda}x are shown in Fig. 7A. As indicated, the IgM secreted by hybridomas A1–4, B1–7, and C1–7 contained L chains with V{kappa}8, V{kappa}21D, and V{lambda}x variable regions, respectively. Two hybridomas produced IgM molecules containing two L chains, one with V{kappa}8 and V{lambda}x and the other with V{lambda}x and V{lambda}1 (our unpublished results). To confirm our mass spectrometric typing results, we used the SMART 5' RACE assay to synthesize full-length cDNA from members of groups B and C and sequenced the expressed rearranged {kappa} gene in B3, B4, and B5 and the rearranged V{lambda}x gene in C1–7. Among all tested members of groups B and C, we recovered L chain sequences corresponding to a V{kappa}21D and V{lambda}x gene, respectively (Fig. 7B). Thus, all seven hybridomas (B1–7) that secreted IgMa molecules cross-reactive with AF6-78 anti-IgMb (shown in Table II) were found to express V{kappa}21D instead of V{kappa}8. Based on the results in Figs. 4–6, we estimate that V{lambda}x- and V{kappa}21D-edited B cells represent ≥40% of IgMa-expressing splenic B cells in 56RV{kappa}8 mice.


Figure 7
View larger version (32K):
[in this window]
[in a new window]

 
FIGURE 7. Identification of L chains secreted by B cell hybridomas of 56RV{kappa}8 mice. A, V{kappa}8, V{kappa}21D, and V{lambda}x L chains produced by hybridomas of 56RV{kappa}8 mice were identified by mass spectrometry. L chains of reduced hybridoma IgM proteins (illustrated in the gel lane to the right of each spectra) were excised from the gels and processed as described in Materials and Methods. In the mass spectra for V{kappa}8 and V{kappa}21D, the common tryptic peptide RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPK derives from the {kappa} constant region (residue C at position 27 is carbamidomethyl). The variable region peptides LLIYWASTR and LLIYAASNLESGIPAR are specific for V{kappa}8 and V{kappa}21D, respectively. Specific peptides for V{lambda}x, VTVLGQPK, and KDGSHSTGDGIPDR are indicated in the V{lambda}x mass spectra. B, The predicted amino acid sequence of the VJ junctional regions as deduced from the nucleotide sequences of rearranged L chain genes for three members in the V{kappa}21D group (B3–5) and for the expressed rearranged L chain genes of members in the V{lambda}x group (C1–7). These results confirmed our typing results by mass spectrometry. Note that the CDR3 region (underlined) for the V{lambda}x hybridoma in C2 is two amino acids (YN) longer than that of the other V{lambda}x-producing hybridomas (C1 and C3–7).

 
IgMa-expressing hybridomas were also examined for rearrangements involving the RS element downstream of the C{kappa} constant region gene (57, 58). Using primers specific for the V{kappa}8 leader, J{kappa}C{kappa} intronic recombining sequence (IRS1) and RS (see Materials and Methods), we recovered PCR products corresponding to an IRS1-RS rearrangement at the tg allele in all V{lambda}x-expressing hybridomas of group C (Table III). We also recovered V{kappa}-RS rearrangements at the wt {kappa} allele in four members of group C using primers specific for RS and the V{kappa} framework 3 region. Thus, expression of V{lambda}x in the 56RV{kappa}8 B cell hybridomas was found to correlate with a RS-mediated deletion of C{kappa} at the V{kappa}8 allele, consistent with earlier findings that {lambda}-expressing B cells frequently show RS-mediated deletions of C{kappa} (57, 58). Rearrangements involving RS were also observed in four of seven V{kappa}21D-expressing hybridomas (Table III).


View this table:
[in this window]
[in a new window]

 
Table III. L chain production and RS{kappa} rearrangements in 56RV{kappa}8 hybridomasa

 
56RV{kappa}21D- and 56RV{lambda}x-expressing hybridomas represent multiple B cell clones

Because most of the hybridomas in groups B and C showed indistinguishable V{kappa}21D-J{kappa} and V{lambda}x-J{lambda} rearrangements, respectively (Fig. 7B), and all retained an unaltered 56R tg (Fig. 8B), we considered that they may have represented only a few clones of expanded B cells. However, when we examined the status of the wt H chain allele in these hybridomas, we found clear evidence of multiclonality (Fig. 8A). Five distinct B cell clones were represented among the seven hybridomas in the V{kappa}21D series; i.e., three showed different DJ rearrangements or junctions (B1, B4, and B5b), four were clonally related and contained the same DJ rearrangement (B2, B3, B5a, and B6), and one retained a germline H chain allele (B7). Seven distinct cell clones were represented among the hybridomas in the V{lambda}x series; six contained different DJ rearrangements or junctions (C1, C2, C4a, C4b, C5, and C7) and one retained a germline H chain allele (C6). Therefore, most V{kappa}21D- and V{lambda}x-expressing B cell hybridomas were clonally distinct and represented independently edited B cells.

IgM molecules secreted by 56RV{kappa}21D- and 56RV{lambda}x-expressing hybridomas retain specificity for DNA

To test the effect of V{kappa}21D and V{lambda}x on the ability of the 56R H chain to bind dsDNA, we compared the relative anti-dsDNA binding of IgM from hybridomas in groups A, B, and C. This comparison was done with the same purified IgM preparations used for ELISA and mass spectrometric analysis of L chains in Table I and Fig. 7. The relative binding of IgM to dsDNA was plotted as a function of the concentration of IgM added to wells containing biotinylated dsDNA attached to avidin D. As shown in Fig. 9A, all tested IgM preparations from the V{kappa}21D and V{lambda}x series retained binding specificity for dsDNA but showed less affinity for dsDNA than IgM preparations from members of the V{kappa}8 group (A1–4). The binding curves for members of the V{kappa}21D group (B1–7) were displaced ~5- to 8-fold to the right of those for the V{kappa}8 group. IgM from B2 and B6 gave similar binding curves consistent with our evidence that these hybridomas represented one and the same clone (Fig. 8). With one exception, the binding curves for members of the V{lambda}x group (C1–7) were displaced ~50- to 100-fold to the right of those for members of the V{kappa}8 group. The one exceptional member (C2) showed much stronger binding to dsDNA than other members in this group. Interestingly, the V{lambda}x-J{lambda}2 junction of C2 contained two additional amino acids (tyrosine and asparagine) not present in other members of the group (Fig. 7B). Thus, the lengthening of the V{lambda}x-J{lambda}2 junction by these two amino acids correlated with an increased strength of anti-dsDNA binding. IgM from all six of the 56RV{kappa}8 hybridomas that produced IgMb failed to bind dsDNA; this is illustrated for two such hybridomas in the top panel of Fig. 9A. Our binding results are consistent with those of Doyle et al. (60) who also found 56RV{lambda}x-expressing B cell hybridomas to produce Ab with specificity for dsDNA, but they differ from those of earlier reports showing the V{kappa}21D and V{lambda}x editors to inhibit completely the binding of 56R to dsDNA (4, 18, 50). The basis for the difference is unclear.

IgM molecules secreted by 56RV{kappa}21D- and 56RV{lambda}x-expressing hybridomas bind apoptotic cells

Because 56RV{kappa}21D- and 56RV{lambda}x-expressing hybridomas secreted IgM Abs that bind dsDNA, albeit with low affinity, it was of interest to know whether these Abs would also bind to apoptotic Jurkat cells since anti-dsDNA Abs often bind to apoptotic cells (61). Specific targets of anti-dsDNA Abs include blebs formed by the protrusion of nuclear fragments from the cell surface. Anti-dsDNA Abs may also cross-react with phospholipid structures associated with the inner plasma membrane that become externalized during apoptosis (61, 62, 63, 64, 65). As shown in Fig. 9B, IgM Abs from 56RV{kappa}8-, 56RV{kappa}21D-, and 56RV{lambda}x-expressing hybridomas showed preferential binding to apoptotic cells over live cells, although the pattern of Ab binding to apoptotic cells was distinct for each group of hybridomas. No appreciable IgM binding to apoptotic (or live) cells was evident with the nonspecific IgM{lambda} control (11E10). 56RV{kappa}8 Abs seemed to bind focal sites on apoptotic plasma membranes, possibly reflecting the recognition of phospholipid domains whose distribution in the membrane was altered by apoptosis (see A4, Fig. 9B). In contrast, 56RV{kappa}21D Abs displayed a preference for individual apoptotic blebs surrounding nuclear fragments or associated with the plasma membrane (B1 and B7, Fig. 9B). 56RV{lambda}x Abs showed relatively sparse binding to the plasma membrane, yet bound dispersed sites in the cytoplasm (C2 and C3, Fig. 9B). Unlike authentic anti-DNA autoantibodies (61), none of the above Abs bound to the surface of nuclear fragments, implying that these Abs do not recognize DNA-histone, subnucleosomal complexes, or intact nucleosomes.


    Discussion
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 
RAG expression and L chain editing in B cells deficient for sIgM

Using sorted B cell subsets from 56RV{kappa}8 mice and scoring for dsDNA breaks at the wt {kappa} allele and V{lambda}x gene, we obtained direct evidence for ongoing secondary L chain rearrangement in BM and splenic anti-DNA B cells. In the BM, dsDNA breaks were prominent in the B cell fraction (B220+sIgMlow) and in cells displaying a pre-B phenotype (B220+CD43IgM). With little or no cell surface Ag receptor, it is not obvious how sIgM–lo cells in 56RV{kappa}8 BM could have been directly induced by self-Ag to undergo L chain rearrangement. Thus, we suggest these cells represent immature anti-DNA B cells that down-regulated their expression of sIgM due to encounter with self-Ag and then greatly elevated RAG expression. L chain editing may be initiated at the onset of Ag encounter and then continue in cells with down-regulated sIgM, consistent with our finding of abundant dsDNA breaks in both B220+sIgMlow and B220+sIgM BM B lineage cells (Fig. 3B). Cells that fail to edit their Ag receptor successfully are presumably deleted, consistent with earlier evidence for deletion of anti-DNA B cells at the pre-B/B transitional stage (66).

In the SPL, dsDNA breaks were detectable in sIgM–low anti-DNA B cells with a T3 and T3' phenotype. The immediate source of T3/T3' splenic B cells in 56RV{kappa}8 mice is not clear and could be BM and/or SPL. These cells might, for example, represent immature/transitional anti-DNA B cells that encountered self-Ag in the BM, down-regulated their sIgM, and then emigrated to SPL where they continued to undergo secondary L chain rearrangement as T3/T3' cells. Alternatively, these cells could derive from immature/transitional anti-DNA B cells that encountered self-Ag in the SPL and then rapidly down-regulated expression of their sIgM (e.g., from that of a T1 cell to that of a T3' cell). Although T3/T3' anti-DNA B cells were deficient for sIgM, they nonetheless expressed intermediate levels of sIgD (Fig. 2C), consistent with the previously described phenotype for T3 cells (19). Since this IgD receptor (sIgDa) would have the same anti-self specificity as sIgMa, it remains an open question as to whether it plays a role in signaling L chain editing in transitional anti-DNA splenic B cells.

RAG expression and L chain editing in the SPL have been reported earlier in immunized mice (67, 68, 69, 70, 71) and in LPS/IL-4-stimulated splenic B cells (72). However, such RAG expression and L chain editing may not occur, as initially thought, in mature splenic (germinal center) B cells. Using transgenic mice with a RAG2-GFP fusion gene inserted into the RAG2 locus (RAG2-GFP mice), Gartner et al. (73) found that most RAG2+ cells appearing in the SPL after immunization corresponded to migrant pre-B/immature B cells (B220lowCD43lowsIgMlow) from the BM. No GFP expression was detectable in sIgMhigh transitional splenic B cells or mature B cells (73, 74). In transgenic mice with GFP under the control of RAG2 regulatory genes, Yu et al. (75) reported that GFP expression does not occur in mature B cells during an immune response although it does occur in immature/transitional splenic B cells (B220low CD24+CD93+). The highest GFP expression was seen in sIgMlow transitional splenic B cells; sIgMhigh transitional splenic B cells showed lower GFP expression (75). Low RAG expression in sIgMhigh transitional splenic B cells has been reported in Ig-transgenic mice (6-1/V{kappa}1A mice) (59). Anti-Igβ stimulation of sIgMhigh transitional splenic B cells from 6-1/V{kappa}1A mice was found to result in slight to moderate up-regulation of RAG expression but not L chain rearrangement as scored by dsDNA breaks at J{kappa} coding elements (59). However, when BCR-induced apoptosis of cultured sIgMhigh transitional splenic B cells is inhibited by coculture with Thy1dullDX5+ cells from normal BM, up-regulated expression of both RAG and dsDNA breaks at J{kappa} coding elements is observed (76, 77). These results suggest that BCR-stimulated sIgMhigh transitional splenic B cells may undergo apoptosis or receptor editing, depending on the microenvironment in which these cells encounter Ag (76, 77). Our findings with 56RV{kappa}8 and nontransgenic C57BL/6 mice extend the studies cited above and show that sIgMlow T3 transitional SPL B cells contain dsDNA breaks indicative of ongoing L chain rearrangement. Similar results were obtained with T3' splenic B cells. Some T3/T3' cells may successfully edit their receptor based on our detection of a L chain editor (V{lambda}x) in the serum of SCID mice engrafted with sorted T3/T3' splenic B cells from 56RV{kappa}8 mice.

L chain editing in 56RV{kappa}8 mice is dependent on the 56R H chain

The presence of V{kappa}21D- and V{lambda}x-edited B cells in the SPL of 56RV{kappa}8 but not 3H9V{kappa}8 mice is attributable to the single amino acid substitution in the H chains encoded by 56R and 3H9 (arginine for aspartate at position 56 in the VH region) and correlates with the known difference in affinity of these H chains for DNA. The 56RV{kappa}8 Ab has high affinity for DNA (binds both ssDNA and dsDNA), whereas the 3H9V{kappa}8 Ab has low affinity for DNA (binds ssDNA but not dsDNA) (18). Using a human {kappa} polymorphism to detect L chain editing at the wt {kappa} allele in 3H9V{kappa}8 mice, Casellas et al. (7) also found that {kappa} (as well as {lambda})-edited B cells were not detectable in these mice. In contrast, {kappa}- and {lambda}-edited B cells were readily detectable in 3H9V{kappa}4 mice (7), which express an anti-dsDNA Ab with comparable affinity for dsDNA as that of the 56RV{kappa}8 Ab (18). Yachimovich et al. (78) reported a lack of L chain editing in anti-DNA double-transgenic mice bearing the D42H (79) and V{kappa}8 tgs, but not in mice bearing the tgs, D42H and V{kappa}4 or V{kappa}1. L chain editing at the active tg allele in the D42H model correlated with the number of available J{kappa} gene segments on the tg alleles (three in V{kappa}1J{kappa}1, one in V{kappa}4J{kappa}4, and none in V{kappa}8J{kappa}5). All of these mice expressed anti-DNA Abs with moderate affinity for dsDNA (78). Although the V{kappa}8 tg can be inactivated by secondary RS-mediated rearrangements (Table II), it cannot express an edited L chain because there are no available J{kappa} coding segments (23). However, when the V{kappa}8 L chain is paired with the strongly self-reactive 56R H chain, as in 56RV{kappa}8 mice, L chain editing readily occurs at the wt {kappa} allele and the {lambda} locus.

Representation of V{kappa}21D- and V{lambda}x-edited B cells in 56RV{kappa}8 mice

No edited B cells expressing V{kappa}21D or V{lambda}x L chains were detectable in 56RV{kappa}8 BM despite clear evidence that L chain editing is ongoing in this tissue. This finding is not really surprising. There are 96 known functional VL genes in the mouse genome (80) and, given that the RAG proteins do not preferentially target V{kappa}21D and V{lambda}x genes, one would not expect a high frequency of 56RV{kappa}21D- and 56RV{lambda}x-expressing B cells to arise in the BM. Moreover, given that edited B cells rapidly exit the BM, there would not be sufficient time for them to accumulate to detectable numbers. V{lambda}x- and V{kappa}21D-edited B cells were, however, detectable in the SPL and represented ~40% of all IgMa-expressing splenic B cells in 56RV{kappa}8 mice. A higher percentage of edited B cells expressing V{kappa}21D or V{lambda}x (~70%) were recovered in our relatively small sample of IgMa-expressing splenic hybridomas. Strikingly, most of the hybridomas were clonally unrelated as evidenced by distinct DJ rearrangements at their wt H chain allele (Fig. 8). Thus, we infer that most V{kappa}21D- and V{lambda}x-expressing cells in the SPL represent independently edited B cells.

IgM proteins from 56RV{kappa}21D- and 56RV{lambda}x-expressing B cell hybridomas showed binding specificity for apoptotic cells (Fig. 9B). The same proteins were also able to bind to dsDNA, albeit with much less affinity than unedited 56RV{kappa}8 Ab as the binding curves of IgM to dsDNA for 56RV{kappa}21D- and 56RV{lambda}x-expressing B cell hybridomas were displaced ~5- to 8- and 50- to 100-fold, respectively, to the right of those for 56RV{kappa}8-expressing B cell hybridomas (Fig. 9A). Whether the edited B cells represented by these hybridomas retained sufficient autoreactivity to be positively selected by self-Ag is open to question. Low self-reactivity could be essential for the survival and maintenance of 56RV{kappa}21D- and 56RV{lambda}x-expressing B cells. Others have previously shown that functional autoreactive cells can be generated in the presence of self-Ag (81, 82) and positively selected (82). Moreover, there is evidence most peripheral B cells may be positively selected by internal and external ligands (83) and that signaling through the BCR is essential for maintenance of mature B cells (84). With the previous findings of others serving as precedent, we suggest that edited anti-DNA B cells expressing V{kappa}21D or V{lambda}x may retain sufficient self-reactivity to allow for their positive selection and maintenance in the presence of self-Ag.

Autoreactive T3 splenic B cells

T3 (and T3') splenic B cells were 3- to 10-fold more frequent in 56RV{kappa}8 mice than in 3H9V{kappa}8 and nontransgenic C.B-17 scid/+ mice. Overrepresentation of T3 splenic B cells has also been observed in transgenic B6.56R mice (85) and in two other Ig-transgenic models with autoreactive B cells (20, 86). In the latter two models, anti-Ars/A1 and anti-HEL/sHEL-transgenic mice, maintenance of the T3 phenotype was found to depend on continuous exposure to self-Ag. Moreover, the T3 cells in anti-HEL/sHEL C57BL/6 mice were shown to be anergic in that they did not mobilize calcium and initiate tyrosine phosphorylation in response to BCR stimulation (20). The T3 cell population in nontransgenic C57BL/6 mice has also been reported to consist mainly of anergic B cells (20, 21).

Does the anergic phenotype of T3 cells necessarily imply that these cells are (all) inactivated and unable to give rise to mature B cells? We think not based on our finding that the splenic B cell population with a T3 (and T3') phenotype in 56RV{kappa}8 and C57BL/6 normal mice contained cells with dsDNA breaks indicative of ongoing L chain rearrangement. Thus, we infer that these B cell populations contain cells attempting to edit their Ag receptor. Assuming T3 splenic B cells undergoing L chain rearrangement in normal wt mice are self-reactive, only those cells that successfully edit their Ag receptor would be expected to survive and give rise to mature B cells. As many L chain rearrangements presumably fail to result in expression of a suitable L chain editor, most T3 splenic B cells would be deleted, consistent with their rapid turnover and anergic phenotype (19, 20, 21).


    Acknowledgments
 
We thank Dr. P-A. Cazenave for providing the 10C5 hybridoma, M. Weigert for the original BALB/c mice with the 3H9, 3H9(56R), and V{kappa}8 sd-tgs; R. Hardy for JH–/– mice; D. Douek for help with the SMART 5'RACE technique; D. Allman, R. Hardy, D. Kappes, and T. Manser for review of this manuscript; and R. Brooks and K. Trush for help in formatting the text and figures. Assistance from personnel in the following CORE facilities of the Fox Chase Cancer Center is gratefully acknowledged: the Flow Cytometry and Cell Sorting Facility, Laboratory Animal Resources, DNA Sequencing Facility, Biochemistry and Biotechnology Facility, and the Hybridoma Facility.


    Disclosures
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 
The authors have no financial conflict of interest.


    Footnotes
 
The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

1 This work was supported by National Institutes of Health Grants CA06927 and CA04946 and an appropriation from the Commonwealth of Pennsylvania. Back

2 K.K. and P.B.N. contributed equally to this work. Back

3 Address correspondence and reprint requests to Dr. Melvin J. Bosma, Fox Chase Cancer Center, 333 Cottman Avenue, Philadelphia, PA 19111. E-mail address: MJ_Bosma{at}fccc.edu Back

4 Abreviations used in this paper: BM, bone marrow; tg, transgene; HEL, hen egg lysosome; sHEL, soluble hen egg lysozyme; sIgM, surface IgM; wt, wild type; FL, fluorescein; LM-PCR, ligation-mediated PCR; RS, recombining sequence; β2m, β2-microglobulin; RT, reverse transcriptase; SPL, spleen; IRS1, intronic recombining sequence 1. Back

Received for publication November 28, 2007. Accepted for publication February 20, 2008.


    References
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 

  1. Tiegs, S. L., D. M. Russell, D. Nemazee. 1993. Receptor editing in self-reactive bone marrow B cells. J. Exp. Med. 177: 1009-1020. [Abstract/Free Full Text]
  2. Radic, M. Z., J. Erickson, S. Litwin, M. Weigert. 1993. B lymphocytes may escape tolerance by revising their receptors. J. Exp. Med. 177: 1165-1173. [Abstract/Free Full Text]
  3. Gay, D., T. Saunders, S. Camper, M. Weigert. 1993. Receptor editing: an approach by autoreactive B cells to escape tolerance. J. Exp. Med. 177: 999-1008. [Abstract/Free Full Text]
  4. Li, H., Y. Jiang, E. L. Prak, M. Z. Radic, M. Weigert. 2001. Editors and editing of anti-DNA receptors. Immunity 15: 947-957. [Medline]
  5. Casellas, R., Q. Zhang, N. Y. Zheng, M. D. Mathias, K. Smith, P. C. Wilson. 2007. Ig{kappa} allelic inclusion is a consequence of receptor editing. J. Exp. Med. 204: 153-160. [Abstract/Free Full Text]
  6. Retter, M. W., D. Nemazee. 1998. Receptor editing occurs frequently during normal B cell development. J. Exp. Med. 188: 1231-1238. [Abstract/Free Full Text]
  7. Casellas, R., T. A. Shih, M. Kleinewietfeld, J. Rakonjac, D. Nemazee, K. Rajewsky, M. C. Nussenzweig. 2001. Contribution of receptor editing to the antibody repertoire. Science 291: 1541-1544. [Abstract/Free Full Text]
  8. Nemazee, D., K. Burki. 1989. Clonal deletion of B lymphocytes in a transgenic mouse bearing anti-MHC class I antibody genes. Nature 337: 562-566. [Medline]
  9. Melamed, D., D. Nemazee. 1997. Self-antigen does not accelerate immature B cell apoptosis, but stimulates receptor editing as a consequence of developmental arrest. Proc. Natl. Acad. Sci. USA 94: 9267-9272. [Abstract/Free Full Text]
  10. Hertz, M., D. Nemazee. 1997. BCR ligation induces receptor editing in IgM+IgD bone marrow B cells in vitro. Immunity 6: 429-436. [Medline]
  11. Pelanda, R., S. Schwers, E. Sonoda, R. M. Torres, D. Nemazee, K. Rajewsky. 1997. Receptor editing in a transgenic mouse model: site, efficiency, and role in B cell tolerance and antibody diversification. Immnunity 7: 765-775.
  12. Goodnow, C. C., J. Crosbie, S. Adelstein, T. B. Lavoie, S. J. Smith-Gill, R. A. Brink, H. Pritchard-Briscoe, J. S. Wotherspoon, R. H. Loblay, K. Raphael, et al 1988. Altered immunoglobulin expression and functional silencing of self-reactive B lymphocytes in transgenic mice. Nature 334: 676-682. [Medline]
  13. Tze, L. E., E. A. Baness, K. L. Hippen, T. W. Behrens. 2000. Ig light chain receptor editing in anergic B cells. J. Immunol. 165: 6796-6802. [Abstract/Free Full Text]
  14. Tze, L. E., K. L. Hippen, T. W. Behrens. 2003. Late immature B cells (IgMhighIgDneg) undergo a light chain receptor editing response to soluble self-antigen. J. Immunol. 171: 678-682. [Abstract/Free Full Text]
  15. Kouskoff, V., G. Lacaud, K. Pape, M. Retter, D. Nemazee. 2000. B cell receptor expression level determines the fate of developing B lymphocytes: receptor editing versus selection. Proc. Natl. Acad. Sci. USA 97: 7435-7439. [Abstract/Free Full Text]
  16. Tze, L. E., B. R. Schram, K. P. Lam, K. A. Hogquist, K. L. Hippen, J. Liu, S. A. Shinton, K. L. Otipoby, P. R. Rodine, A. L. Vegoe, et al 2005. Basal immunoglobulin signaling actively maintains developmental stage in immature B cells. PLoS Biol. 3: e82[Medline]
  17. Mehr, R., G. Shahaf, A. Sah, M. Cancro. 2003. Asynchronous differentiation models explain bone marrow labeling kinetics and predict reflux between the pre- and immature B cell pools. Int. Immunol. 15: 301-312. [Abstract/Free Full Text]
  18. Chen, C., M. Z. Radic, J. Erikson, S. A. Camper, S. Litwin, R. R. Hardy, M. Weigert. 1994. Deletion and editing of B cells that express antibodies to DNA. J. Immunol. 152: 1970-1982. [Abstract]
  19. Allman, D., R. C. Lindsley, W. DeMuth, K. Rudd, S. A. Shinton, R. R. Hardy. 2001. Resolution of three nonproliferative immature splenic B cell subsets reveals multiple selection points during peripheral B cell maturation. J. Immunol. 167: 6834-6840. [Abstract/Free Full Text]
  20. Merrell, K. T., R. J. Benschop, S. B. Gauld, K. Aviszus, D. Decote-Ricardo, L. J. Wysocki, J. C. Cambier. 2006. Identification of anergic B cells within a wild-type repertoire. Immunity 25: 953-962. [Medline]
  21. Teague, B. N., Y. Pan, P. A. Mudd, B. Nakken, Q. Zhang, P. Szodoray, X. Kim-Howard, P. C. Wilson, A. D. Farris. 2007. Cutting edge: transitional T3 B cells do not give rise to mature B cells, have undergone selection, and are reduced in murine lupus. J. Immunol. 178: 7511-7515. [Abstract/Free Full Text]
  22. Chen, C., Z. Nagy, E. L. Prak, M. Weigert. 1995. Immunoglobulin heavy chain gene replacement: a mechanism of receptor editing. Immunity 3: 747-755. [Medline]
  23. Prak, E. L., M. Weigert. 1995. Light chain replacement: a new model for antibody gene rearrangement. J. Exp. Med. 182: 541-548. [Abstract/Free Full Text]
  24. Bosma, G. C., J. Oshinsky, K. Kiefer, P. B. Nakajima, D. Charan, C. Congelton, M. Radic, M. J. Bosma. 2006. Development of functional B cells in a line of SCID mice with transgenes coding for anti-double-stranded DNA antibody. J. Immunol. 176: 889-898. [Abstract/Free Full Text]
  25. Chen, J., M. Trounstine, F. W. Alt, F. Young, C. Kurahara, J. F. Loring, D. Huszar. 1993. Immunoglobulin gene rearrangement in B cell deficient mice generated by targeted deletion of the JH locus. Int. Immunol. 5: 647-656. [Abstract/Free Full Text]
  26. Shulman, M., C. D. Wilde, G. Kohler. 1978. A better cell line for making hybridomas secreting specific antibodies. Nature 276: 269-270. [Medline]
  27. Kotloff, D. B., M. J. Bosma, N. R. Ruetsch. 1993. V(D)J recombination in peritoneal B cells of leaky scid mice. J. Exp. Med. 178: 1981-1994. [Abstract/Free Full Text]
  28. Sanchez, P., B. Nadel, P.-A. Cazenave. 1991. V{lambda}-J{lambda} rearrangements are restricted within a V-J-C recombination unit in the mouse. Eur. J. Immunol. 21: 907-911. [Medline]
  29. Bosma, G. C., J. Kim, T. Urich, D. M. Fath, M. G. Cotticelli, N. R. Ruetsch, M. Z. Radic, M. J. Bosma. 2002. DNA-dependent protein kinase activity is not required for immunoglobulin class switching. J. Exp. Med. 196: 1483-1495. [Abstract/Free Full Text]
  30. Chang, Y., M. J. Bosma, G. C. Bosma. 1999. Extended duration of DH-JH rearrangement in immunoglobulin heavy chain transgenic mice: implications for regulation of allelic exclusion. J. Exp. Med. 189: 1295-1305. [Abstract/Free Full Text]
  31. Schlissel, M. S., D. Baltimore. 1989. Activation of immunoglobulin {kappa} gene rearrangement correlates with induction of germline {kappa} gene transcription. Cell 58: 1001-1007. [Medline]
  32. Erikson, J., M. Z. Radic, S. A. Camper, R. R. Hardy, C. Carmack, M. Weigert. 1991. Expression of anti-DNA immunoglobulin transgenes in non-autoimmune mice. Nature 349: 331-334. [Medline]
  33. Schlissel, M. S., L. M. Corcoran, D. Baltimore. 1991. Virus-transformed pre-B cells show ordered activation but not inactivation of immunoglobulin gene rearrangement and transcription. J. Exp. Med. 173: 711-720. [Abstract/Free Full Text]
  34. Nakajima, P. B., J. P. Menetski, D. B. Roth, M. Gellert, M. J. Bosma. 1995. V-D-J rearrangements at the T cell receptor {delta} locus in mouse thymocytes of the {alpha}β lineage. Immunity 3: 609-621. [Medline]
  35. Nakajima, P. B., M. J. Bosma. 2002. Variable diversity joining recombination: nonhairpin coding ends in thymocytes of SCID and wild-type mice. J. Immunol. 169: 3094-3104. [Abstract/Free Full Text]
  36. Coleclough, C., R. P. Perry, K. Karjalainen, M. Weigert. 1981. Aberrant rearrangements contribute significantly to the allelic exclusion of immunoglobulin gene expression. Nature 290: 372-378. [Medline]
  37. Chenchik, A., Y. Zhu, L. Diatchenko, R. Li, J. Hill, P. D. Siebert. 1998. Generation and use of high quality cDNA from small amounts of total RNA by SMART PCR. P. Siebert, and J. larrick, eds. RT-PCR Methods for Gene Cloning and Analysis 305-319. BioTechniques Books, Natick, MA.
  38. Shevchenko, A., M. Wilm, O. Vorm, M. Mann. 1996. Mass spectrometric sequencing of proteins silver-stained polyacrylamide gels. Anal. Chem. 68: 850-858. [Medline]
  39. Spodik, B., S. H. Seeholzer, T. R. Coleman. 2002. Using Xenopus egg extracts to modify recombinant proteins. E.A. Coleman, ed. Protein-Protein Interactions 355-374. Cold Spring Harbor Lab. Press, Cold Spring Harbor.
  40. Schuerenberg, M., C. Luebbert, H. Eickhoff, M. Kalkum, H. Lehrach, E. Nordhoff. 2000. Prestructured MALDI-MS sample supports. Anal. Chem. 72: 3436-3442. [Medline]
  41. Gobom, J., M. Schuerenberg, M. Mueller, D. Theiss, H. Lehrach, E. Nordhoff. 2001. {alpha}-Cyano-4-hydroxycinnamic acid affinity sample preparation: a protocol for MALDI-MS peptide analysis in proteomics. Anal. Chem. 73: 434-438. [Medline]
  42. Perkins, D. N., D. J. Pappin, D. M. Creasy, J. S. Cottrell. 1999. Probability-based protein identification by searching sequence databases using mass spectrometry data. Electrophoresis 20: 3551-3567. [Medline]
  43. Carmack, C. E., S. A. Camper, J. J. Mackle, W. U. Gerhard, M. G. Weigert. 1991. Influence of a V{kappa}8 L chain transgene on endogenous rearrangements and the immune response to the HA(Sb) determinant on influenza virus. J. Immunol. 147: 2024-2033. [Abstract]
  44. Bosma, G. C., R. P. Custer, M. J. Bosma. 1983. A severe combined immunodeficiency mutation in the mouse. Nature 301: 527-530. [Medline]
  45. Kiefer, K., J. Oshinsky, J. Kim, P. B. Nakajima, G. C. Bosma, M. J. Bosma. 2007. The catalytic subunit of DNA-protein kinase (DNA-PKCs) is not required for Ig class-switch recombination. Proc. Natl. Acad. Sci. USA 104: 2843-2848. [Abstract/Free Full Text]
  46. Rao, M., W. T. Lee, D. H. Conrad. 1987. Characterization of a monoclonal antibody directed against the murine B lymphocyte receptor for IgE. J. Immunol. 138: 1845-1851. [Abstract]
  47. Rolink, A. G., J. Andersson, F. Melchers. 1998. Characterization of immature B cells by a novel monoclonal antibody, by turnover and by mitogen reactivity. Eur. J. Immunol. 28: 3738-3748. [Medline]
  48. Loder, F., B. Mutschler, R. J. Ray, C. J. Paige, P. Sideras, R. Torres, M. C. Lamers, R. Carsetti. 1999. B cell development in the spleen takes place in discrete steps and is determined by the quality of B cell receptor-derived signals. J. Exp. Med. 190: 75-89. [Abstract/Free Full Text]
  49. Chung, J. B., R. A. Sater, M. L. Fields, J. Erikson, J. G. Monroe. 2002. CD23 defines two distinct subsets of immature B cells which differ in their responses to T cell help signals. Int. Immunol. 14: 157-166. [Abstract/Free Full Text]
  50. Li, Y., Y. Louzoun, M. Weigert. 2004. Editing anti-DNA B cells by Vlambdax. J. Exp. Med. 199: 337-346. [Abstract/Free Full Text]
  51. Roth, D. B., C. Zhu, M. Gellert. 1993. Characterization of broken DNA molecules associated with V(D)J recombination. Proc. Natl. Acad. Sci. USA 90: 10788-10792. [Abstract/Free Full Text]
  52. Schlissel, M., A. Constantinescu, T. Morrow, M. Baxter, A. Peng. 1993. Double-strand signal sequence breaks in V(D)J recombination are blunt, 5'-phosphorylated, RAG-dependent, and cell cycle regulated. Genes Dev. 7: 2520-2532. [Abstract/Free Full Text]
  53. Gellert, M.. 2002. V(D)J recombination: RAG proteins, repair factors, and regulation. Annu. Rev. Biochem. 71: 101-132. [Medline]
  54. Ramsden, D. A., M. Gellert. 1995. Formation and resolution of double-strand break intermediates in V(D)J rearrangement. Genes Dev. 9: 2409-2420. [Abstract/Free Full Text]
  55. Roth, D. B., P. B. Nakajima, J. P. Menetski, M. J. Bosma, M. Gellert. 1992. V(D)J recombination in mouse thymocytes: double-strand breaks near T cell receptor {delta} rearrangement signals. Cell 69: 41-53. [Medline]
  56. Roth, D. B., J. P. Menetski, P. B. Nakajima, M. J. Bosma, M. Gellert. 1992. V(D)J recombination: broken DNA molecules with covalently sealed (hairpin) coding ends in scid mouse thymocytes. Cell 70: 983-991. [Medline]
  57. Durdik, J., M. W. Moore, E. Selsing. 1984. Novel {kappa} light-chain gene rearrangements in mouse {lambda} light chain-producing B lymphocytes. Nature 307: 749-752. [Medline]
  58. Moore, M. W., J. Durdik, D. M. Persiani, E. Selsing. 1985. Deletions of {kappa} chain constant region genes in mouse {lambda} chain-producing B cells involve intrachromosomal DNA recombinations similar to V-J joining. Proc. Natl. Acad. Sci. USA 82: 6211-6215. [Abstract/Free Full Text]
  59. Wang, H., J. Feng, C. F. Qi, Z. Li, H. C. Morse, III, S. H. Clarke. 2007. Transitional B cells lose their ability to receptor edit but retain their potential for positive and negative selection. J. Immunol. 179: 7544-7552. [Abstract/Free Full Text]
  60. Doyle, C. M., J. Han, M. G. Weigert, E. T. Prak. 2006. Consequences of receptor editing at the l locus: multireactivity and light chain secretion. Proc. Natl. Acad. Sci. USA 103: 11264-11269. [Abstract/Free Full Text]
  61. Radic, M., T. Marion, M. Monestier. 2004. Nucleosomes are exposed at the cell surface in apoptosis. J. Immunol. 172: 6692-6700. [Abstract/Free Full Text]
  62. Casciola-Rosen, L. A., G. Anhalt, A. Rosen. 1994. Autoantigens targeted in systemic lupus erythematosus are clustered in two populations of surface structures on apoptotic keratinocytes. J. Exp. Med. 179: 1317-1330. [Abstract/Free Full Text]
  63. Casciola-Rosen, L. A., G. J. Anhalt, A. Rosen. 1995. DNA-dependent protein kinase is one of a subset of autoantigens specifically cleaved early during apoptosis. J. Exp. Med. 182: 1625-1634. [Abstract/Free Full Text]
  64. Cocca, B. A., S. N. Seal, P. D’Agnillo, Y. M. Mueller, P. D. Katsikis, J. Rauch, M. Weigert, M. Z. Radic. 2001. Structural basis for autoantibody recognition of phosphatidylserine-β2 glycoprotein I and apoptotic cells. Proc. Natl. Acad. Sci. USA 98: 13826-13831. [Abstract/Free Full Text]
  65. Cocca, B. A., A. M. Cline, M. Z. Radic. 2002. Blebs and apoptotic bodies are B cell autoantigens. J. Immunol. 169: 159-166. [Abstract/Free Full Text]
  66. Chen, C., Z. Nagy, M. Z. Radic, R. R. Hardy, D. Huszar, S. A. Camper, M. Weigert. 1995. The site and stage of anti-DNA B-cell deletion. Nature 373: 252-255. [Medline]
  67. Han, S., B. Zheng, D. G. Schatz, E. Spanopoulou, G. Kelsoe. 1996. Neoteny in lymphocytes: Rag1 and Rag2 expression in germinal center B cells. Science 274: 2094-2097. [Abstract/Free Full Text]
  68. Han, S., S. R. Dillon, B. Zheng, M. Shimoda, M. S. Schlissel, G. Kelsoe. 1997. V(D)J recombinase activity in a subset of germinal center B lymphocytes. Science 278: 301-305. [Abstract/Free Full Text]
  69. Hikida, M., M. Mori, T. Takai, K. Tomochika, K. Hamatani, H. Ohmori. 1996. Reexpression of RAG-1 and RAG-2 genes in activated mature mouse B cells. Science 274: 2092-2094. [Abstract/Free Full Text]
  70. Hikida, M., M. Mori, T. Kawabata, T. Takai, H. Ohmori. 1997. Characterization of B cells expressing recombination activating genes in germinal centers of immunized mouse lymph nodes. J. Immunol. 158: 2509-2512. [Abstract]
  71. Hikida, M., H. Ohmori. 1998. Rearrangement of {lambda} light chain genes in mature B cells in vitro and in vivo: function of reexpressed recombination-activating gene (RAG) products. J. Exp. Med. 187: 795-799. [Abstract/Free Full Text]
  72. Papavasiliou, F., R. Casellas, H. Suh, X. F. Qin, E. Besmer, R. Pelanda, D. Nemazee, K. Rajewsky, M. C. Nussenzweig. 1997. V(D)J recombination in mature B cells: a mechanism for altering antibody responses. Science 278: 298-301. [Abstract/Free Full Text]
  73. Gartner, F., F. W. Alt, R. J. Monroe, K. J. Seidl. 2000. Antigen-independent appearance of recombination activating gene (RAG)-positive bone marrow B cells in the spleens of immunized mice. J. Exp. Med. 192: 1745-1754. [Abstract/Free Full Text]
  74. Monroe, R. J., K. J. Seidl, F. Gaertner, S. Han, F. Chen, J. Sekiguchi, J. Wang, R. Ferrini, L. Davidson, G. Kelsoe, F. W. Alt. 1999. RAG2:GFP knockin mice reveal novel aspects of RAG2 expression in primary and peripheral lymphoid tissues. Immunity 11: 201-212. [Medline]
  75. Yu, W., H. Nagaoka, M. Jankovic, Z. Misulovin, H. Suh, A. Rolink, F. Melchers, E. Meffre, M. C. Nussenzweig. 1999. Continued RAG expression in late stages of B cell development and no apparent re-induction after immunization. Nature 400: 682-687. [Medline]
  76. Sandel, P. C., J. G. Monroe. 1999. Negative selection of immature B cells by receptor editing or deletion is determined by site of antigen encounter. Immunity 10: 289-299. [Medline]
  77. Sandel, P. C., M. Gendelman, G. Kelsoe, J. G. Monroe. 2001. Definition of a novel cellular constituent of the bone marrow that regulates the response of immature B cells to B cell antigen receptor engagement. J. Immunol. 166: 5935-5944. [Abstract/Free Full Text]
  78. Yachimovich, N., G. Mostoslavsky, Y. Yarkoni, I. Verbovetski, D. Eilat. 2002. The efficiency of B cell receptor (BCR) editing is dependent on BCR light chain rearrangement status. Eur. J. Immunol. 32: 1164-1174. [Medline]
  79. Pewzner-Jung, Y., D. Friedmann, E. Sonoda, S. Jung, K. Rajewsky, D. Eilat. 1998. B cell deletion, anergy, and receptor editing in "knock in" mice targeted with a germline-encoded or somatically mutated anti-DNA heavy chain. J. Immunol. 161: 4634-4645. [Abstract/Free Full Text]
  80. Martinez-Jean, C., G. Folch, M. P. Lefranc. 2001. Nomenclature and overview of the mouse (Mus musculus and Mus sp.) immunoglobulin {kappa} (IGK) genes. Exp. Clin. Immunogenet. 18: 255-279. [Medline]
  81. Hannum, L. G., D. Ni, A. M. Haberman, M. G. Weigert, M. J. Shlomchik. 1996. A disease-related rheumatoid factor autoantibody is not tolerized in a normal mouse: implications for the origins of autoantibodies in autoimmune disease. J. Exp. Med. 184: 1269-1278. [Abstract/Free Full Text]
  82. Hayakawa, K., M. Asano, S. A. Shinton, M. Gui, D. Allman, C. L. Stewart, J. Silver, R. R. Hardy. 1999. Positive selection of natural autoreactive B cells. Science 285: 113-116. [Abstract/Free Full Text]
  83. Gu, H., D. Tarlinton, W. Muller, K. Rajewsky, I. Forster. 1991. Most peripheral B cells in mice are ligand selected. J. Exp. Med. 173: 1357-1371. [Abstract/Free Full Text]
  84. Lam, K.-P., R. Kuhn, K. Rajewsky. 1997. In vivo ablation of surface immunoglobulin on mature B cells by inducible gene targeting results in rapid cell death. Cell 90: 1073-1083. [Medline]
  85. Sekiguchi, D. R., L. Yunk, D. Gary, D. Charan, B. Srivastava, D. Allman, M. G. Weigert, E. T. Prak. 2006. Development and selection of edited B cells in B6.56R mice. J. Immunol. 176: 6879-6887. [Abstract/Free Full Text]
  86. Benschop, R. J., K. Aviszus, X. Zhang, T. Manser, J. C. Cambier, L. J. Wysocki. 2001. Activation and anergy in bone marrow B cells of a novel immunoglobulin transgenic mouse that is both hapten specific and autoreactive. Immunity 14: 33-43. [Medline]



This article has been cited by other articles:


Home page
J. Immunol.Home page
L. Yunk, W. Meng, P. L. Cohen, R. A. Eisenberg, and E. T. Luning Prak
Antibodies in a Heavy Chain Knock-In Mouse Exhibit Characteristics of Early Heavy Chain Rearrangement
J. Immunol., July 1, 2009; 183(1): 452 - 461.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
P. B. Nakajima, K. Kiefer, A. Price, G. C. Bosma, and M. J. Bosma
Two Distinct Populations of H Chain-Edited B Cells Show Differential Surrogate L Chain Dependence
J. Immunol., March 15, 2009; 182(6): 3583 - 3596.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
P. Y. Tsao, J. Jiao, M. Q. Ji, P. L. Cohen, and R. A. Eisenberg
T Cell-Independent Spontaneous Loss of Tolerance by Anti-Double-Stranded DNA B Cells in C57BL/6 Mice
J. Immunol., December 1, 2008; 181(11): 7770 - 7777.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow Request Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Kiefer, K.
Right arrow Articles by Bosma, M. J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Kiefer, K.
Right arrow Articles by Bosma, M. J.
Right arrowPubmed/NCBI databases
*Substance via MeSH


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS