The JI PBL Intereron Source
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     
 


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Hallström, T.
Right arrow Articles by Riesbeck, K.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Hallström, T.
Right arrow Articles by Riesbeck, K.
The Journal of Immunology, 2006, 177: 430-436.
Copyright © 2006 by The American Association of Immunologists

Haemophilus influenzae Surface Fibrils Contribute to Serum Resistance by Interacting with Vitronectin1

Teresia Hallström, Elena Trajkovska, Arne Forsgren and Kristian Riesbeck2

Medical Microbiology, Department of Laboratory Medicine, Lund University, Malmö University Hospital, Malmö, Sweden


    Abstract
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 
Vitronectin inhibits the membrane attack complex of the complement system and is found both in plasma and the extracellular matrix. In this study, we have identified the outer membrane protein Haemophilus surface fibrils (Hsf) as the major vitronectin-binding protein in encapsulated H. influenzae type b. A H. influenzae mutant devoid of Hsf showed a significantly decreased binding to both soluble and immobilized vitronectin as compared with the wild-type counterpart. Moreover, Escherichia coli-expressing Hsf at the surface strongly adhered to immobilized vitronectin. Importantly, the H. influenzae Hsf mutant had a markedly reduced survival as compared with the wild-type bacterium when incubated with normal human serum. A series of truncated Hsf fragments were recombinantly manufactured in E. coli. The vitronectin binding regions were located within two separate binding domains. In conclusion, Hsf interacts with vitronectin and thereby inhibits the complement-mediated bactericidal activity, and thus is a major H. influenzae virulence factor.


    Introduction
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 
Haemophilus influenzae is a Gram-negative human pathogen responsible for a variety of diseases. Encapsulated H. influenzae strains belong to one of six serotypes (a–f), of which type b is the most virulent serotype (1, 2). The most serious and sometimes life-threatening conditions are invasive diseases (e.g., septicemia, epiglottitis, and meningitis) caused by encapsulated H. influenzae serotype b (Hib)3 (3). In contrast, nontypable H. influenzae accounts for the majority of local disease and upper and lower respiratory tract infections (e.g., bronchitis, sinusitis, and acute otitis media) and is after pneumococci the second most common pathogen isolated from children with acute otitis medium (1, 2).

A crucial factor in the pathogenesis of both encapsulated and nonencapsulated H. influenzae involves the initial adherence to the mucosa in the respiratory tract (4). If the bacteria manage to overcome the mucociliary escalator, they may colonize and cause damage to the epithelial cells and breakdown of tight junctions (5, 6). Consequently, the bacteria reach the basement membrane and the extracellular matrix (ECM), and may penetrate into deeper tissue layers and consequently into the circulation. Studies on the interaction of H. influenzae and tissue samples from the human respiratory tract show that H. influenzae has been associated with disrupted epithelial cells and exposed ECM proteins such as fibronectin, collagen, vitronectin, and laminin (7, 8, 9).

Both pilus and nonpilus adhesins of H. influenzae have displayed adherence to ECM proteins. H. influenzae pili, which hemagglutinate human erythrocytes and adhere to human oropharyngeal epithelial cells (10, 11, 12, 13, 14, 15, 16), exhibit adherence to fibronectin and heparin-binding ECM proteins. The nonpilus adhesin Haemophilus adhesion and penetration protein was reported as a binder of fibronectin, laminin, and collagen IV (8).

The major nonpilus adhesin in Hib is Haemophilus surface fibrils (Hsf) (17). The hsf gene is highly conserved among encapsulated H. influenzae strains and encodes a 2414-aa-long protein consisting of three repetitive domains with high sequence similarity. Hsf is found as short, thin surface fibrils at the bacterial surface and is associated with adherence to epithelial cells (16). In 25% of all unencapsulated strains, a homologue to the Hsf protein, H. influenzae adhesin (Hia), can be found (17, 18, 19). The hia gene, which is shorter than the hsf gene, encodes for a protein with a size of 1098 aa and harbors only one domain that corresponds to the three repetitive domains in Hsf. However, Southern blot analysis has revealed that hsf and hia are alleles of the same locus with 81% similarity and 72% identity (17).

The complement system is the first line of innate defense against pathogenic microorganisms, and activation of this system leads to a cascade of protein deposition on the bacterial surface, resulting in formation of the membrane attack complex (MAC) and opsonization of the pathogen, followed by phagocytosis. A regulatory component of MAC is the multifunctional glycoprotein vitronectin that is found both in plasma and in the ECM (20). It exists as a 75-kDa protein in the ECM and is found in plasma as two truncated forms: 75 and 65 kDa.

Both Hib and nontypable H. influenzae bind surface-associated vitronectin equally well, and it has been suggested that adhesins are involved in the binding because both fimbriated and nonfimbriated strains adhere to a similar degree (9). In this study, we demonstrate that Hsf is the major vitronectin-binding protein in Hib. A H. influenzae mutant devoid of Hsf displayed a decreased binding to both soluble and immobilized vitronectin. Furthermore, Hsf-dependent interaction with vitronectin was inhibited by heparin. Interestingly, H. influenzae wild type survived a significantly longer time as compared with the Hsf mutant counterpart when exposed to normal human serum (NHS). Finally, we show that two separate binding domains of Hsf are involved in the vitronectin binding.


    Materials and Methods
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 
Bacterial strains and culture conditions

The type b strain H. influenzae Eagan and the clinical capsule-deficient H. influenzae isolate RM804 have been described in detail (21, 22). Bacteria, wild type, and mutants were routinely cultured in brain-heart-infusion liquid broth supplemented with NAD and hemin (both at 10 µg/ml) or on chocolate agar plates at 37°C in a humid atmosphere containing 5% CO2. The Hsf-deficient mutant was cultured in the presence of 15 µg/ml kanamycin (Merck). The Streptococcus pyogenes was a clinical isolate from our department and was grown in brain-heart infusion liquid broth. Escherichia coli BL21 (DE3) and DH5{alpha} were grown in Luria Bertani liquid broth, whereas Hsf transformants were cultured with 50 µg/ml ampicillin (Sigma-Aldrich).

Antibodies

Rabbits were immunized i.m. with 200 µg of rHsf54–608 emulsified in CFA (Difco and BD Biosciences), and boosted on days 18 and 36 with the same dose of protein in IFA. Blood was drawn 3 wk later. To increase the specificity, the anti-Hsf antiserum was affinity purified with Sepharose-conjugated rHsf. To ensure that the polyclonal Ab (pAb) reacted with rHsf, the pAb was analyzed in ELISA. Hsf (100 ng/well) were immobilized in microtiter plates and incubated at increasing concentrations of the antiserum, followed by HRP-conjugated goat anti-rabbit pAb diluted 1/1000 (Dakopatts). The FITC-conjugated goat anti-human vitronectin and donkey anti-goat pAb were purchased from Serotec, and the mouse anti-human vitronectin and the HRP-conjugated anti-mouse pAb were from Invitrogen Life Technologies and Dakopatts, respectively.

Manufacture of Hsf-deficient H. influenzae

The 5' end of hsf (GenBank accession no. U41852) was amplified as two cassettes using DyNAzyme II DNA Polymerase (Finnzymes) introducing the restriction enzyme sites BamHI and EcoRI or EcoRI and XhoI in addition to specific uptake sequences in the two cassettes (23). Resulting PCR fragments (825 and 918 bp, respectively) were digested and cloned into pBluescript SK+/–. A kanamycin resistance gene cassette from pUC4K was amplified by PCR, introducing the restriction enzyme site for EcoRI. After digestion, the PCR product was ligated into the truncated hsf gene fragment. H. influenzae strains Eagan and RM804 were transformed according to the M-IV method of Poje and Redfield (23). Resulting mutants were verified by PCR, and the Hsf expression was analyzed by Western blot and flow cytometry (Figs. 1 and 2B).


Figure 1
View larger version (35K):
[in this window]
[in a new window]
 
FIGURE 1. Construction of a Hsf-deficient H. influenzae mutant. A, Schematic drawing of Hsf. The numbers above the bars refer to amino acid residue positions in the full-length protein. Regions of sequence similarity are indicated with {square}. The arrow indicates where the gene was disrupted by a kanamycin casette in the mutant. B, The H. influenzae RM804{Delta}hsf mutant was confirmed by PCR. The H. influenzae RM804 wild type (lane 2) did not contain a kanamycin cassette, whereas the {Delta}hsf mutant did (lane 3). pBluescript containing the hsf casettes and the kanamycin cassette was used as a positive control (lane 4). C, Western blot analysis of H. influenzae RM804{Delta}hsf mutant compared with the wild-type counterpart. To extract the OMPs, 3% Empigen was used. Resulting proteins were analyzed by Western blots using a rabbit anti-Hsf antiserum and HRP-conjugated goat anti-rabbit pAb. The RM804{Delta}hsf mutant lacked the high m.w. complex. A typical experiment of three is demonstrated. Similar results were obtained with H. influenzae Eagan and its corresponding mutant.

 

Figure 2
View larger version (33K):
[in this window]
[in a new window]
 
FIGURE 2. The Hsf-deficient mutant shows a decreased binding to vitronectin. A, Vitronectin from human plasma analyzed for purity by SDS-PAGE. The fraction contains two truncated forms (75 and 65 kDa, as indicated by arrows). B, Flow cytometry profiles of H. influenzae wild type and a Hsf-deficient mutant showed a correlation between Hsf expression and vitronectin binding. The RM804 wild-type isolate and RM804{Delta}hsf were incubated with a rabbit anti-Hsf antiserum and finally a FITC-conjugated anti-rabbit antiserum. C, The Hsf-deficient mutants showed a significantly decreased binding to soluble vitronectin, compared with the wild-type counterpart. RM804 wild type and RM804{Delta}hsf were incubated with vitronectin, followed by goat anti-vitronectin pAb. Finally, a FITC-conjugated anti-goat antiserum was added. A typical experiment of six is demonstrated. D, H. influenzae Eagan wild type and RM804 wild type bind vitronectin in a dose-dependent manner. The H. influenzae Eagan{Delta}hsf and RM804{Delta}hsf mutant displayed a much weaker binding to the different concentrations of vitronectin. Bacteria were incubated with increasing concentrations (0.1–2.5 µg) of vitronectin, followed by an anti-vitronectin pAb. FITC-conjugated anti-goat pAb was subsequently added, followed by flow cytometry analysis. The mean values of three experiments are shown. Error bars indicate SD.

 
DNA cloning and protein expression

All truncated Hsf constructs were manufactured using PCR-amplified fragments. The open reading frame of the hsf gene (U41852) from H. influenzae strain RM804 was used as a template. All Hsf constructs were amplified by PCR using DyNAzyme II DNA Polymerase (Finnzymes) with specific primers introducing the restriction enzyme sites BamHI and HindIII. The sequence encoding for the signal peptide was excluded. To express full-length Hsf, a NcoI restriction enzyme site was introduced. The PCR products were cloned into pET26+, except for the full-length Hsf, which was cloned into both pET26 and pET16. The resulting plasmids were transformed into the host E. coli DH5{alpha}, followed by transformation into the expressing host E. coli BL21(DE3) (Novagen). All constructs were sequenced using the BigDye Terminator Cycle Sequencing v. 3.1 Ready reaction kit (Applied Biosystems). To produce recombinant proteins, bacteria were grown to mid-log phase (OD600 0.5–1.0), followed by 1–3 h of induction with 1 mM isopropyl-1-thio-beta-D-galactoside (Saveen Werner). Inclusion bodies were purified according to a standard protocol (Novagen). The resulting proteins were examined by SDS-PAGE, Western blots, and ELISA.

Outer membrane protein (OMP) preparations

Bacteria grown to stationary phase were washed with 50 mM Tris-HCl buffer (pH 8.0). The pellet was resuspended in Tris-HCl buffer containing 3% Empigen (Calbiochem) and protease inhibitors (Complete; Roche) (24). OMPs were extracted by rotating the mixture at 37°C for 2 h. The bacterial cells, stripped of their outer membranes, were centrifuged, and the supernatants were collected. Thereafter, the supernatants were analyzed on SDS-PAGE and Western blots.

SDS-PAGE and Western blots

Recombinant proteins were subjected to SDS-PAGE (10%) (25) and stained with Coomassie brilliant blue R-250 (Bio-Rad). Electrophoretical transfer of protein bands from the gel to an Immobilon-P membrane (Millipore) was done at 35 V overnight to transfer the high m.w. complexes. After transfer, the Immobilon-P membrane was blocked in PBS with 0.1% Tween 20 (PBS-Tween) containing 5% milk powder. After several washings in PBS-Tween, the membrane was incubated with rabbit anti-Hsf antiserum diluted 1/100 in PBS-Tween, including 2% milk powder, for 1 h at room temperature. HRP-conjugated goat anti-rabbit antiserum diluted 1/1000 was added after washings in PBS-Tween. After incubation for 40 min at room temperature and additional washings in PBS-Tween, development was performed with ECL Western blotting detection reagents (Amersham Biosciences). To analyze the purity of vitronectin obtained from human plasma (Sigma-Aldrich), 2 µg was subjected to SDS-PAGE and Coomassie stained.

Flow cytometry analysis

The Hsf protein expression and the capacity for H. influenzae to bind vitronectin were analyzed by flow cytometry. The wild-type strains and the Hsf-deficient mutants were grown in broth overnight and washed once in PBS containing 2% BSA (PBS-BSA). Bacteria (108) were incubated with rabbit anti-Hsf pAb. Bacteria were washed and incubated for 30 min on ice with FITC-conjugated goat anti-rabbit pAb (Dakopatts), diluted according to the manufacturers’ instructions. After three additional washes, the bacteria were analyzed in a flow cytometer (EPICS, XL-MCL; Corixa). To analyze H. influenzae binding to vitronectin, bacteria were incubated with 0.1–2.5 µg of vitronectin for 1 h in 37°C. After washings, bacteria were incubated with goat anti-human vitronectin pAb for 30 min at ice, before incubation with the FITC-conjugated donkey anti-goat pAb. After additional washes, bacteria were analyzed in the flow cytometer. All incubations were kept in PBS-BSA, and the washings were done with the same buffer. Secondary pAb were added separately as negative controls for each strain analyzed. Hsf-expressing E. coli was analyzed for vitronectin binding according to a standard protocol (26). In the competition assay, the H. influenzae wild type was preincubated with increasing concentrations of heparin (Heparin Leo, Lövens Kemiske Fabrik, or Sigma-Aldrich) or vitronectin-derived synthetic peptides, followed by 1 µg of vitronectin. Peptides spanning the heparin binding domain used in this study were vitronectin348–361 (KKQRFRHRNRKGYR) and vitronectin341–370 (APRPSLAKKQRFRHRNRKGYRSQRGHSRGR) (Innovagen).

Binding of H. influenzae to immobilized vitronectin

Glass slides were coated with 2 µg of human plasma vitronectin, air dried at room temperature, and then washed twice with PBS. The slides were incubated with prechilled bacteria at late exponential phase (OD600 = 0.9) for 2 h at room temperature, washed twice with PBS, and followed by Gram staining.

Serum bactericidal assay

NHS was pooled from five healthy volunteers. Inactivated serum was used as a control. The H. influenzae wild type and corresponding Hsf mutant were diluted in DGVB2+ (2.5 mM veronal buffer (pH 7.3), containing 0.1% (w/v) gelatin, 1 mM MgCl2, and 0.15 mM CaCl2). Bacteria (104 CFU) were incubated in 5% of NHS or heat-inactivated NHS in a final volume of 100 µl at 37°C. At different time points, 10-µl aliquots were removed and spread onto chocolate agar plates. After 18 h of incubation at 37°C, CFU were determined.

ELISAs

Microtiter plates (Nunc-Immuno Module) were coated with 40 µM purified rHsf fragments in 0.1 M Tris-HCl (pH 9.0) overnight at 4°C. Plates were washed with PBS-0.05% Tween 20 and blocked for 1 h at room temperature with PBS containing 2% BSA. After washings, the wells were incubated for 1 h at room temperature with vitronectin (5 µg/ml) in 2% BSA. Thereafter, the plates were washed and incubated with goat anti-human vitronectin pAb for 1 h. After additional washings, HRP-conjugated anti-goat pAb was added and incubated at room temperature for 40 min. Plates were developed and measured at an OD of 450 nm.

To determine the vitronectin concentration in NHS following incubation with wild-type or mutant H. influenzae, microtiter plates were coated with goat anti-human vitronectin pAb in 0.1 M Tris-HCl (pH 9.0) at 4°C overnight. Plates were washed, blocked, and incubated with NHS before (0 min) and after 20-min incubation with RM804 or the corresponding mutant. Thereafter, the plates were washed and incubated with mouse anti-human vitronectin mAb, followed by HRP-conjugated anti-mouse pAb.

Protein labeling and competition assays

Purified rHsf608–1351 was labeled with 0.05 mol iodine (Amersham Biosciences) per molecule of protein, using the chloramine-T method (27). To define saturating conditions of 125I-labeled Hsf608–1351, vitronectin was incubated at increasing concentrations with 125I-labeled Hsf608–1351 in microtiter plates. The competition assays were essentially performed as described elsewhere (26). Briefly, microtiter plates were incubated with 0.065 µg of vitronectin overnight at 4°C in 75 mM NaCO3 (pH 9.6). Thereafter, the wells were washed and blocked, as described above. After four washings, 125I-labeled Hsf608–1351 was added, together with various concentrations of unlabeled proteins diluted in blocking buffer, and followed by an overnight incubation at 4°C. After four washings, the radioactivity was measured in a gamma counter.


    Results
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 
Characterization of a Hsf-deficient H. influenzae mutant

Two Hib strains (RM804 and Eagan) were mutated by introduction of a kanamycin resistance gene cassette in the gene encoding for Hsf (Fig. 1A). Resulting mutants were confirmed by PCR, and the absence of Hsf expression was proven by analysis of OMPs in Western blots using a specific anti-Hsf antiserum (Fig. 1, B and C). The RM804{Delta}hsf mutant was deficient in a high m.w. complex corresponding to Hsf (Fig. 1C). The H. influenzae Hsf mutant was also analyzed by flow cytometry using anti-Hsf pAb (Fig. 2B). Similar results were obtained with the H. influenzae Eagan wild type and the corresponding mutant (data not shown).

Hsf-deficient H. influenzae shows a significantly decreased binding to vitronectin

To determine whether Hsf interacted with vitronectin, soluble vitronectin (Fig. 2A) at increasing concentrations was incubated with H. influenzae and the Hsf mutants, followed by flow cytometry analysis using polyclonal anti-vitronectin Abs (Fig. 2C). The H. influenzae RM804 and Eagan isolates significantly bound vitronectin at a concentration of 0.5–2.5 µg. In contrast, a strongly decreased vitronectin binding was observed with RM804{Delta}hsf and Eagan{Delta}hsf as compared with the wild-type counterpart (Fig. 2D). To further show that Hsf interacts with soluble vitronectin, Hsf-expressing E. coli (Fig. 3A) was included in our study. E. coli with Hsf at the surface bound vitronectin (1–5 µg) in a dose-dependent manner, whereas no binding was detected with the control bacteria (Fig. 3B).


Figure 3
View larger version (21K):
[in this window]
[in a new window]
 
FIGURE 3. Hsf-expressing E. coli binds vitronectin. A, Flow cytometry profiles showing the expression of Hsf on the surface of E. coli. B, Hsf-expressing E. coli bound vitronectin in a dose-dependent manner, whereas E. coli did not. A, Bacteria were incubated with rabbit anti-Hsf, followed by an FITC-conjugated anti-rabbit pAb. B, Bacteria were incubated with increasing concentrations (1–5 µg) of vitronectin, followed by an anti-vitronectin pAb. FITC-conjugated anti-goat pAb was subsequently added, followed by flow cytometry analysis. The mean values of three experiments are shown. Error bars indicate SEM.

 
To investigate the attachment of bacteria to immobilized vitronectin, H. influenzae RM804 and its corresponding Hsf mutant were applied to vitronectin-coated glass slides. The H. influenzae RM804 wild type was found to strongly adhere to the vitronectin-coated glass slides (Fig. 4A). This was in contrast to the H. influenzae RM804{Delta}hsf mutant that barely bound the immobilized vitronectin (Fig. 4B). Similar results were obtained with H. influenzae Eagan and the corresponding Hsf mutant (data not shown). To further prove that Hsf interacts with immobilized vitronectin, Hsf-expressing E. coli was tested. In parallel with H. influenzae, Hsf-expressing E. coli adhered to the vitronectin-coated glass slides (Fig. 4C), whereas only a few bacteria were detected when the control E. coli wild type was analyzed (Fig. 4D).


Figure 4
View larger version (104K):
[in this window]
[in a new window]
 
FIGURE 4. The H. influenzae RM804{Delta}hsf mutant does not bind immobilized vitronectin. A, The H. influenzae wild type was able to adhere at a high density on vitronectin-coated glass slides, whereas B, H. influenzae RM804{Delta}hsf mutant adhered poorly. C, E. coli-expressing Hsf at the bacterial cell surface strongly adhered to the vitronectin-coated glass slide. In contrast, D, E. coli adhered poorly. Glass slides were coated with vitronectin and incubated with the bacteria. After several washes, bacteria were Gram stained. A typical experiment of three is presented. Similar results were obtained with Eagan and its corresponding mutant.

 
Hsf-vitronectin interaction is inhibited by heparin

The vitronectin molecule harbors different functional groups, which are involved in, for example, cell attachment, collagen binding, and glycosaminoglycan binding. Three heparin binding domains exist in the N terminus and the C terminus of the vitronectin molecule (Fig. 5A) (19, 28). To further investigate the nature of the interaction of vitronectin to H. influenzae, a series of blocking experiments with heparin was performed. The H. influenzae wild type was incubated with heparin at increasing concentrations, followed by addition of vitronectin. This commercially available heparin inhibited the binding of vitronectin to H. influenzae in a dose-dependent manner (Fig. 5B). The binding was inhibited >80% when heparin at 10 µg/ml was added. BSA did not interfere with the binding (data not shown). Another commercial heparin preparation showed similar results. To exclude sterical hindrance of the heparin molecule, we also tested the capacity of heparin to block vitronectin binding to group A streptococci (Fig. 5B). A significant vitronectin binding to streptococci was observed in analogy with previously published data (29), whereas any inhibitory effect of heparin on vitronectin binding to group A streptococci was not observed at heparin concentrations up to 500 µg/ml. To examine the vitronectin-Hsf interaction in detail, the peptides spanning the heparin binding site, vitronectin348–361 and vitronectin341–370, were preincubated with vitronectin, followed by addition of H. influenzae. These peptides did not block the vitronectin binding. Thus, the N-terminal part of the vitronectin molecule is most likely involved in the Hsf-vitronectin interaction.


Figure 5
View larger version (17K):
[in this window]
[in a new window]
 
FIGURE 5. H. influenzae binds human plasma vitronectin, and the interaction is inhibited by heparin. A, Schematic picture of vitronectin showing the heparin binding domains. B, Inhibition of the Hsf-vitronectin interaction by heparin. The vitronectin binding of H. influenzae ({blacksquare}) and S. pyogenes ({circ}) in the absence of heparin was defined as 100%. Vitronectin binding of H. influenzae decreased with increasing concentrations of heparin (0.1–500 µg/ml), whereas no inhibition could be detected when S. pyogenes was incubated with heparin. Vitronectin (1 µg) binding was measured by flow cytometry, as described in Fig. 2. The mean values of three experiments are shown. Error bars indicate SD.

 
Hsf is crucial for H. influenzae survival in human serum

Vitronectin plays a major role in the complement cascade by inhibiting the MAC of complement (19). To analyze the importance of Hsf in H. influenzae survival when exposed to NHS, the wild-type strains RM804 and Eagan, in addition to the corresponding mutants, were tested in a serum bactericidal assay. The wild-type strains were significantly more resistant to NHS as compared with the mutants devoid of Hsf (Fig. 6). Both the wild-type strain and the mutant were resistant to heat-inactivated NHS.


Figure 6
View larger version (23K):
[in this window]
[in a new window]
 
FIGURE 6. Both H. influenzae {Delta}hsf mutants were more serum sensitive than the H. influenzae wild types. Eagan, RM804, Eagan{Delta}hsf mutant, and RM804{Delta}hsf mutant were incubated in the presence of 5% NHS. The RM804 wild type was also incubated with 5% heat-inactivated NHS. Numbers of bacteria (CFU) before addition of NHS were defined as 100%. The mean values of three experiments are shown. Error bars indicate SD.

 
Vitronectin was bound to wild-type bacteria, but not to the mutant after incubation with NHS for 20 min. Quantification of residual vitronectin in serum was performed with ELISA after bacteria were spun down. Interestingly, the vitronectin serum concentration decreased with 13.3 ± 2.5% after exposure to H. influenzae, whereas no difference was seen with the Hsf-deficient mutants. Taken together, Hsf significantly contributed to H. influenzae serum resistance.

The vitronectin binding regions are located within two separate domains of Hsf

To further analyze the interactions of Hsf with vitronectin, Hsf54–2414 was recombinantly produced in E. coli, coated on microtiter plates, and incubated with increasing concentrations of vitronectin. Bound vitronectin was detected by an anti-human vitronectin pAb, followed by incubation with an HRP-conjugated anti-goat pAb, as can be seen in Fig. 7. Hsf54–2414 bound soluble vitronectin, and the interaction was dose dependent.


Figure 7
View larger version (16K):
[in this window]
[in a new window]
 
FIGURE 7. Recombinantly expressed Hsf54–2414 binds vitronectin in a dose-dependent manner. Hsf54–2414 (10 µg/ml) was coated on microtiter plates and incubated with increasing concentrations of vitronectin, followed by detection with goat anti-human vitronectin pAb and HRP-conjugated anti-goat pAb. The background binding was subtracted from all the samples. Mean values of two experiments are shown, and error bars indicate SD.

 
To define the vitronectin binding domain of Hsf, recombinant proteins spanning the entire molecule were manufactured. Vitronectin was incubated with immobilized Hsf fragments, and the interaction was quantified by ELISA. Interestingly, two major binding domains were found, i.e., Hsf608–1351 and Hsf1536–2414 (Fig. 8).


Figure 8
View larger version (11K):
[in this window]
[in a new window]
 
FIGURE 8. The active vitronectin binding domains of Hsf are located between Hsf608–1351 and Hsf1536–2414. Truncated proteins derived from Hsf are shown. All fragments were tested for binding to vitronectin by ELISA; 40 µM of each fragment was coated on microtiter plates and incubated with 5 µg/ml vitronectin. Bound vitronectin was detected with goat anti-human vitronectin pAb, followed by HRP-conjugated anti-goat pAb. Results are mean values of three experiments and error bars indicate SD.

 
The binding of Hsf608–1351 to vitronectin is dose dependent and specific

The interaction between vitronectin and the most efficient binding domain (Hsf608–1351) was further confirmed using a competition assay after the saturated conditions of vitronectin and 125I-labeled Hsf608–1351 had been defined (Fig. 9A). Vitronectin was incubated with 125I-labeled Hsf608–1351 in the presence of increasing Hsf608–1351 concentrations. Unlabeled Hsf608–1351 specifically inhibited the binding between 125I-labeled Hsf608–1351 and vitronectin (Fig. 9B). A total of 95 nM Hsf608–1351 was required to block the vitronectin/125I-labeled Hsf608–1351 interaction by 50% (IC50).


Figure 9
View larger version (11K):
[in this window]
[in a new window]
 
FIGURE 9. The binding between Hsf608–1351 and vitronectin is specific because Hsf608–1351 competes with iodine-labeled Hsf608–1351. A, To define saturating conditions, increasing concentrations of 125I-labeled Hsf608–1351 were incubated with vitronectin. B, 125I-labeled Hsf608–1351 (60 kcpm/well) was added together with increasing concentrations of unlabeled Hsf608–1351 to microtiter plates coated with vitronectin. Binding at the lowest competitor (i.e., unlabeled Hsf608–1351) concentration was defined as 100%. The mean values of three experiments are shown. Error bars correspond to SD.

 

    Discussion
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 
In the present work, we demonstrate a novel interaction between the encapsulated respiratory pathogen Hib and the important complement inhibitor vitronectin. Complement resistance is crucial for bacterial virulence. Binding of complement inhibitors such as vitronectin, C4BP, or factor H is an efficient strategy used by serum-resistant pathogens (30, 31, 32). Several studies have indicated that complement proteins and regulators are present in the human respiratory tract (33, 34). Moreover, complement activity can be detected in the ECM during inflammation (34, 35).

Hsf is a major adhesin in Hib (17). It is a large, highly conserved autotransporter protein, which extrudes as thin fibrils from the bacterial surface. Flow cytometry analysis of the Hsf-deficient mutant revealed that Hsf is the major vitronectin-binding protein in encapsulated H. influenzae. Hsf-expressing H. influenzae and E. coli transformants bound soluble vitronectin at increasing concentrations (Figs. 2 and 3B). This finding is in contrast to what has been shown in a previous study, in which no binding of H. influenzae to soluble vitronectin was found (9). In addition to H. influenzae, Staphylococcus aureus, E. coli, and beta-hemolytic streptococci are efficient binders of soluble vitronectin (29, 36). Furthermore, we demonstrate that the Hsf-expressing H. influenzae and E. coli transformants both bound to immobilized vitronectin (Fig. 4, A and C). In contrast, when Hsf was deleted in H. influenzae, a significantly decreased binding was observed (Fig. 4B). Three heparin binding domains of the vitronectin molecule (residues 82–137, 175–219, and 348–376) have been identified (Fig. 5A) (20, 28). Heparin inhibited the binding between Hsf-expressing H. influenzae and vitronectin. Two different commercial preparations of heparin were tested with similar results. To further prove the specificity of the heparin blocking, S. pyogenes was included in our study. The binding of S. pyogenes to vitronectin was not inhibited by heparin (Fig. 5B). This result suggests that the interaction between heparin and H. influenzae is specific. Peptides encompassing the C-terminal heparin binding domain, vitronectin348–361 and vitronectin341–370, were also used in blocking experiments. However, any blocking could not be detected with the two peptides, suggesting that the N-terminal heparin binding domains are involved in the interaction.

The H. influenzae devoid of Hsf had a markedly reduced survival as compared with the wild type when exposed to NHS (Fig. 6). The ability to bind vitronectin suggests that Hsf uses the capacity of vitronectin to inhibit the complement-mediated attack. An important function of vitronectin is inhibition of the MAC of the complement cascade that is the first line of defense (20, 37). Vitronectin binds C5b-7, which is one of the end products in the complement cascade, and inhibits attachment to the cell membrane and induction of cell lysis of the bacteria (37, 38). It also binds the C5b-9 complex and blocks the tubular polymerization of C9, which is responsible for induction of the cell lysis. These two mechanisms make it impossible for the complement to attach to the surface of the bacteria, resulting in bacterial survival. Interestingly, it has been suggested that Yersinia enterocolitica OMP YadA acts in a similar fashion as vitronectin by sterically hindering the formation of the MAC (39). In addition to inhibiting the complement system, vitronectin is involved in attachment and spreading of endothelial cells to the ECM and in wound healing by binding the thrombin-antithrombin III complex (20, 38). Furthermore, vitronectin promotes the coagulation cascade by binding and activating the plasminogen activator inhibitor 1.

Localization of the vitronectin binding domains of Hsf is an important step in defining the function of Hsf. Recombinantly produced Hsf54–2414 bound vitronectin in a dose-dependent manner (Fig. 7). In addition, Hsf608–1351 and Hsf1536–2414 from the clinical isolate H. influenzae RM804 contained two vitronectin binding domains. Hsf608–1351 displayed the highest affinity for vitronectin and showed both a dose-dependent and specific binding to vitronectin (Fig. 9). These data were confirmed by dot-blot assay, in which nitrocellulose membranes were coated with vitronectin and incubated with 125I-labeled Hsf fragments (data not shown). During preparation of this manuscript, St. Geme and coworkers (40) demonstrated that Hsf binds Chang epithelial cells via two acidic binding domains. These domains comprise aa 537–652 and 1904–2022. They also identified a third binding pocket (Hsf1214–1338), which did not bind to Chang cells. Our strongest binding domains contain two of these three adhesive binding pockets. Hsf is anchored in the outer membrane by its C-terminal translocator domain, and one Hsf fiber may thus be able to bind two vitronectin molecules and stabilizing adherence despite the physical forces in the respiratory tract, which includes the mucociliary escalator, sneezing, and coughing (41).

Vitronectin is also a component of the ECM (20). Binding of H. influenzae to exposed ECM components may contribute to bacterial adherence, which is an essential step in the bacterial pathogenesis. One hypothesis is that these interactions contribute to the spread of bacteria through tissue barriers into secondary infection sites. Previous studies have shown that H. influenzae can interact with ECM and reconstituted basement membranes from cultured human epithelial cells (12). Binding to ECM proteins makes the bacteria able to reach deeper tissue layers of the mucosa. Hsf-mediated bacterial attachment to vitronectin may be an important factor in initial colonization and spread of the bacteria to new sites of infection. The ability to bind vitronectin is of great importance for several bacterial species. Neisseria gonorrhoeae probably uses vitronectin as a bridge for attachment and invasion of human cells (41). Binding of N. gonorrhoeae to specific integrins can trigger endocytosis of vitronectin and consequently engulfment of the bacteria. The interaction with the integrin receptor occurs by direct binding or through binding of vitronectin. In addition, vitronectin mediates attachment of Candida albicans to endothelial cells and of Pneumocystis carinii to bronchial epithelial cells in the lower respiratory tract (42, 43).

In conclusion, we have presented several lines of evidence on H. influenzae Hsf binding to vitronectin, a factor that inhibits the MAC formation in the complement system, preventing complement-induced cell lysis. This interaction may also contribute to bacterial colonization and spread of H. influenzae. Hsf is the major vitronectin-binding protein and consists of two separate binding domains. Hsf binding to vitronectin contributes to H. influenzae serum resistance and, consequently, virulence.


    Disclosures
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 
The authors have no financial conflict of interest.


    Footnotes
 
The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

1 This work was supported by grants from the Alfred Österlund Foundation, the Anna and Edwin Berger Foundation, the Crafoord Foundation, the Greta and Johan Kock Foundation, the Swedish Medical Research Council, the Swedish Society of Medicine, and the Cancer Foundation at the University Hospital in Malmö. Back

2 Address correspondence and reprint requests to Dr. Kristian Riesbeck, Medical Microbiology, Department of Laboratory Medicine, Malmö University Hospital, Lund University, SE-205 02 Malmö, Sweden. E-mail address: kristian.riesbeck{at}med.lu.se Back

3 Abbreviations used in this paper: Hib, H. influenzae serotype b; ECM, extracellular matrix; Hia, H. influenzae adhesin; Hsf, H. influenzae surface fibril; MAC, membrane attack complex; NHS, normal human serum; pAb, polyclonal Ab; OMP, outer membrane protein. Back

Received for publication November 1, 2005. Accepted for publication April 6, 2006.


    References
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 Disclosures
 References
 

  1. Turk, D. C.. 1984. The pathogenicity of Haemophilus influenzae. J. Med. Microbiol. 18: 1-16. [Medline]
  2. Jacobs, M. R., R. Dagan, P. C. Appelbaum, D. J. Burch. 1998. Prevalence of antimicrobial-resistant pathogens in middle ear fluid: multinational study of 917 children with acute otitis media. Antimicrob. Agents Chemother. 42: 589-595. [Abstract/Free Full Text]
  3. Broome, C. V.. 1987. Epidemiology of Haemophilus influenzae type b infections in the United States. Pediatr. Infect. Dis. J. 6: 779-782. [Medline]
  4. Murphy, T. F., J. M. Bernstein, D. M. Dryja, A. A. Campagnari, M. A. Apicella. 1987. Outer membrane protein and lipooligosaccharide analysis of paired nasopharyngeal and middle ear isolates in otitis media due to nontypeable Haemophilus influenzae: pathogenic and epidemiologic observations. J. Infect. Dis. 5: 960-962.
  5. Read, R. C., R. Wilson, A. Rutman, V. Lund, H. C. Todd, A. P. Brain, P. K. Jeffery, P. J. Cole. 1991. Interaction of nontypeable Haemophilus influenzae with human respiratory mucosa in vitro. J. Infect. Dis. 163: 549-558. [Medline]
  6. Wilson, R., R. Read, P. Cole. 1992. Interaction of Haemophilus influenzae with mucus, cilia, and respiratory epithelium. J. Infect. Dis. 165: 100-102.
  7. St. Geme, J. W., III, M. L. De la Morena, S. Falkow. 1994. A Haemophilus influenzae IgA protease-like protein promotes intimate interaction with human epithelial cells. Mol. Microbiol. 14: 217-233. [Medline]
  8. Fink, D. L., B. A. Green, J. W. St. Geme, III. 2002. The Haemophilus influenzae Hap autotransporter binds to fibronectin, laminin, and collagen IV. Infect. Immun. 70: 4902-4907. [Abstract/Free Full Text]
  9. Eberhard, T., M. Ullberg. 2002. Interaction of vitronectin with Haemophilus influenzae. FEMS Immun. Med. Microbiol. 34: 215-219. [Medline]
  10. Hultgren, S. J., S. Abraham, M. Caparon, P. Falk, J. W. St. Geme, III, S. Normark. 1993. Pilus and nonpilus bacterial adhesins: assembly and function in cell recognition. Cell 73: 887-901. [Medline]
  11. Stull, T. L., P. M. Mendelman, J. E. Haas, M. A. Schoenborn, K. D. Mack, A. L. Smith. 1984. Characterization of Haemophilus influenzae type b fimbriae. Infect. Immun. 46: 787-796. [Abstract/Free Full Text]
  12. Virkola, R., M. Brummer, H. Rauvala, L. van Alphen, T. K. Korhonen. 2002. Interaction of fimbriae of Haemophilus influenzae with heparin-binding extracellular matrix proteins. J. Infect. Dis. 173: 1137-1147.
  13. Ecevit, I. Z., K. W. McCrea, M. M. Pettigrew, A. Sen, C. F. Marrs, J. R. Gilsdorf. 2004. Prevalence of the HifBC, hmw1A, hmw2A, hmwC, and hia genes in Haemophilus influenzae isolates. J. Clin. Microbiol. 42: 3065-3072. [Abstract/Free Full Text]
  14. Barenkamp, S. J., E. Leininger. 1992. Cloning, expression, and DNA sequence analysis of genes encoding nontypeable Haemophilus influenzae high-molecular-weight surface-exposed proteins related to filamentous hemagglutinin of Bordetella pertussis. Infect. Immun. 60: 1302-1313. [Abstract/Free Full Text]
  15. St. Geme, J. W., III, S. Falkow, S. J. Barenkamp. 1993. High-molecular-weight proteins of nontypable Haemophilus influenzae mediate attachment to human epithelial cells. Proc. Natl. Acad. Sci. USA 90: 2875-2879. [Abstract/Free Full Text]
  16. Barenkamp, S. J., J. W. St. Geme, III. 1996. Identification of a second family of high-molecular-weight adhesion proteins expressed by nontypeable Haemophilus influenzae. Mol. Microbiol. 19: 1215-1223. [Medline]
  17. St. Geme, J. W., III, D. Cutter, S. J. Barenkamp. 1996. Characterization of the genetic locus encoding Haemophilus influenzae type b surface fibrils. J. Bacteriol. 69: 695-705. [Medline]
  18. St. Geme, J. W., III, D. Cutter. 2000. The Haemophilus influenzae Hia adhesin is an autotransporter protein that remains uncleaved at the C terminus and fully cell associated. J. Bacteriol. 182: 6005-6013. [Abstract/Free Full Text]
  19. Laarmann, S., D. Cutter, T. Juehne, S. J. Barenkamp, J. W. St. Geme, III. 2002. The Haemophilus influenzae Hia autotransporter harbors two adhesive pockets that reside in the passenger domain and recognize the same host cell receptor. Mol. Microbiol. 46: 731-743. [Medline]
  20. Schvartz, I., D. Seger, S. Shaltiel. 1999. Vitronectin. Int. J. Biochem. Cell Biol. 31: 539-534. [Medline]
  21. Kroll, J. S., R. Moxon. 1988. Capsulation and gene copy number at the cap locus of Haemophilus influenzae type b. J. Bacteriol. 170: 859-864. [Abstract/Free Full Text]
  22. Musser, J. M., J. S. Kroll, D. M. Granoff, E. R. Moxon, B. R. Brodeur, J. Campos, H. Dapernet, W. Fredriksen, J. Hanel, G. Hammond, et al 1990. Global genetic structure and molecular epidemiology of encapsulated Haemophilus influenzae. Rev. Infect. Dis. 12: 75-111. [Medline]
  23. Poje, G., J. R. Redfield. 2003. Transformation of Haemophilus influenzae. Methods Mol. Med. 71: 57-70. [Medline]
  24. Möllenkvist, A., T. Nordström, C. Halldén, J. J. Christensen, A. Forsgren, K. Riesbeck. 2003. The Moraxella catarrhalis immunoglobulin D-binding protein MID has conserved sequences and is regulated by a mechanism corresponding to phase variation: the Moraxella catarrhalis immunoglobulin D-binding protein MID has conserved sequences and is regulated by a mechanism corresponding to phase variation. J. Bacteriol. 185: 2285-2295. [Abstract/Free Full Text]
  25. Laemmli, U. K.. 1970. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 227: 680-685. [Medline]
  26. Nordström, T., A. M. Blom, T. T. Tan, A. Forsgren, K. Riesbeck. 2005. Ionic binding of C3 to the human pathogen Moraxella catarrhalis is unique mechanism for combating innate immunity. J. Immunol. 175: 3628-3636. [Abstract/Free Full Text]
  27. Greenwood, F. C., W. M. Hunter. 1963. The preparation of 131I-labeled human growth hormone of high specific radioactivity. Biochem. J. 89: 114-123. [Medline]
  28. Liang, O. D., S. Rosenblatt, G. S. Chhatwal, K. T. Preissner. 1997. Identification of novel heparin-binding domains of vitronectin. FEBS Lett. 407: 169-172. [Medline]
  29. Chhatwal, G. S., K. T. Preissner, G. Müller-Berghaus, H. Blobel. 1987. Specific binding of the human S protein (vitronectin) to streptococci, Staphylococcus aureus, and Esherichia coli. Infect. Immun. 55: 1878-1883. [Abstract/Free Full Text]
  30. Blom, A. M., A. Rytkonen, P. Vasquez, G. Lindahl, B. Dahlbäck, A. B. Jonsson. 2001. A novel interaction between type IV pili of Neisseria gonorrhoeae and the human complement regulator C4B-binding protein. J. Immunol. 166: 6764-6770. [Abstract/Free Full Text]
  31. Lindahl, G., U. Sjöbring, E. Johnsson. 2000. Human complement regulators; a major target for pathogenic microorganisms. Curr. Opin. Immunol. 12: 44-51. [Medline]
  32. Nordström, T., A. M. Blom, A. Forsgren, K. Riesbeck. 2004. The emerging pathogen Moraxella catarrhalis interacts with complement inhibitor C4b binding protein through ubiquitous surface proteins A1 and A2. J. Immunol. 173: 4598-4606. [Abstract/Free Full Text]
  33. Persson, C., I. Erjefält, U. Alkner, C. Baumgarten, L. Greiff, B. Gustavsson, A. Luts, U. Pipkorn, F. Sundler, L. Svensson, et al 1991. Plasma exudation as a first line respiratory mucosal defense. Clin. Exp. Allergy 21: 17-24. [Medline]
  34. Greiff, D., I. Erjefält, C. Svensson, P. Wollmer, U. Alkner, M. Andersson, C. G. Persson. 1993. Plasma exudation and solute absorption across airway mucosa. Clin. Physiol. 13: 219-233. [Medline]
  35. Rauterberg, E. W.. 1998. K. Rother, III, and G. O. Till, III, eds. The Complement System 287 Springer Verlag, Berlin.
  36. Hussain, M., K. Becker, C. Von Eiff, J. Schrenzel, G. Peters, M. Herrmann. 2001. Identification and characterization of a novel 38.5-kilodalton cell surface protein of Staphylococcus aureus with extended-spectrum binding activity for extracellular matrix and plasma proteins. J. Bacteriol. 183: 6778-6786. [Abstract/Free Full Text]
  37. Podack, E. R., H. J. Müller-Eberhard. 1979. Isolation of human S-protein, an inhibitor of the membrane attack complex of complement. J. Biol. Chem. 254: 9908-9914. [Free Full Text]
  38. Preissner, K. T.. 1991. Structure and biological role of vitronectin. Annu. Rev. Cell Biol. 7: 275-310. [Medline]
  39. Pilz, D., T. Vocke, J. Heesemann, V. Brade. 1992. Mechanism of YadA-mediated serum resistance of Yersinia enterocolitica serotype 03. Infect. Immun. 60: 189-195. [Abstract/Free Full Text]
  40. Cotter, S. E., H. Yeo, T. Juehne, J. W. St. Geme, III. 2005. Architecture and adhesive activity of the Haemophilus influenzae Hsf adhesin. J. Bacteriol. 187: 4656-4664. [Abstract/Free Full Text]
  41. Dehio, M., O. G. Gómez-Duarte, C. Dehio, T. F. Meyer. 1998. Vitronectin-dependent invasion of epithelial cells by Neisseria gonorrhoeae involves {alpha}v integrin receptors. FEBS Lett. 424: 84-88. [Medline]
  42. Spreghini, J., A. Gismondi, M. Piccoli, G. Santoni. 1999. Evidence for v3 and v5 integrin-like vitronectin (VN) receptors in Candida albicans and their involvement in yeast cell adhesion to VN. J. Infect. Dis. 180: 156-166. [Medline]
  43. Limper, A. H., J. E. Standing, O. A. Hoffman, M. Castro, L. W. Neese. 1993. Vitronectin binds to Pneumocystis carinii and mediates organism attachment to cultured lung epithelial cells. Infect. Immun. 61: 4302-439. [Abstract/Free Full Text]



This article has been cited by other articles:


Home page
J. Immunol.Home page
T. Hallstrom, P. F. Zipfel, A. M. Blom, N. Lauer, A. Forsgren, and K. Riesbeck
Haemophilus influenzae Interacts with the Human Complement Inhibitor Factor H
J. Immunol., July 1, 2008; 181(1): 537 - 545.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Respir. Cell Mol. Bio.Home page
T. Manolov, T. T. Tan, A. Forsgren, and K. Riesbeck
Moraxella-Dependent {alpha}1-Antichymotrypsin Neutralization: A Unique Virulence Mechanism
Am. J. Respir. Cell Mol. Biol., May 1, 2008; 38(5): 609 - 617.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
T. Hallstrom, H. Jarva, K. Riesbeck, and A. M. Blom
Interaction with C4b-Binding Protein Contributes to Nontypeable Haemophilus influenzae Serum Resistance
J. Immunol., May 15, 2007; 178(10): 6359 - 6366.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Hallström, T.
Right arrow Articles by Riesbeck, K.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Hallström, T.
Right arrow Articles by Riesbeck, K.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS