|
|
||||||||


* Institute of Medical Microbiology and Immunology, University of Ulm, Ulm, Germany;
Institut Pasteur, Unité dImmunité Cellulaire Antivirale, Department dImmunologie, Paris, France; and
Institute of Hepatology, University College London, London, United Kingdom
| Abstract |
|---|
|
|
|---|
| Introduction |
|---|
|
|
|---|
Genetic (nucleic acid or DNA) vaccination is a potent tool to elicit CD8+ T cell responses (11, 12). Expression vectors used in DNA vaccines contain a transcription unit composed of a heterologous promoter/enhancer sequence, the Ag-encoding sequence, and termination sequences. The constructs are designed such that the Ag is expressed from the primary open reading frame with the first ATG motif of the Ag-encoding sequence located downstream of the promoter. We have reported different strategies to construct vectors that can deliver an extended spectrum of immunogenic information. These involved the following approaches: 1) different Ags were coexpressed from a single transcription unit by incorporating internal ribosomal entry sequences between two (or even more) genes cloned into a bi-(multi)cistronic vector to allow their coexpression under control of a single promoter (14, 15). 2) Bidirectional human CMV (HCMV)-derived promoter elements allow coexpression of two Ags by generating two separate expression units up- and downstream of the promoter sequence (16). 3) Two overlapping reading frames of a single sequence that encode two defined viral Ags (under a single heterologous promoter control) allow the delivery of more antigenic information in a compact form by an expression plasmid of limited size (17). In the present study, we analyzed whether CD8+ T cell responses can be generated from cryptic products translated from other than the primary ORF encoded by DNA vaccines (3).
The 3.2-kb genome of the hepatitis B virus (HBV), one of the smallest known viral genomes, contains four partially overlapping ORFs encoding the core, polymerase (Pol), surface (HBsAg), and trans activator (X) proteins (Fig. 1A) (18, 19). The HBsAg-encoding sequence overlaps the sequence encoding Pol (Fig. 1B) (18). In the present study, we analyzed an HCMV-driven DNA vaccine that encodes the small HBsAg in the primary ORF and an overlapping C-terminal Pol344832 fragment in an alternative (out-of-frame) ORF. No endogenous HBV-specific promoter sequences (19, 20) are located in this HBV sequence. Multispecific MHC class I-restricted epitopes to Pol and HBsAg have been characterized (21, 22, 23, 24, 25, 26, 27). The Pol344832 fragment encoded in the alternative ORF contained at least three different A2-restricted epitopes (Figs. 1 and 2) and, thus, it can be used as a defined model Ag for cryptic transcription/translation products expressed from alternative reading frames. Immunization experiments showed that the pCI/SX vaccine efficiently coprimed CD8+ T cells specific for A2-restricted epitopes processed from HBsAg and from cryptic Pol-specific translation products. We showed that: 1) the HCMV promoter plays a critical role in generating cryptic translational products from alternative Pol ORF that give rise to immunogenic Pol803811 epitope, and 2) HCMV promoter-driven Pol constructs, encoding different Pol fragments in the alternative or primary reading frame, elicited comparable levels of Pol3-specific T cell responses.
|
|
| Materials and Methods |
|---|
|
|
|---|
C57BL/6J (B6) mice (H-2b) and HLA-A2 transgenic (A2-tg) HHB mice were bred and kept under standard pathogen-free conditions in the animal colony of Ulm University. Male and female mice were used at 1216 wk of age.
Vector constructs
HBV Pol-encoding plasmids: pCI/Pol. The HBV Pol was amplified by PCR from the plasmid pTKTHBV2(a generous gift of A. Meyer, Martinsried, Munich, Germany), using a forward primer with a KpnI site (AAAGGTACCATGCCCCTATCCTATCAACACTTCCG) and a reverse primer with a SalI site (AAAGTCGACTCACGGTGGTCTCCATGCGAC). The product was cloned into pCI vector (catalogue number E1731; Promega) using KpnI/SalI. pCI/cT-Pol585832: The Pol585832 -encoding fragment was amplified by PCR from the plasmid pTKTHBV2, using a forward primer with a KpnI site (AAAGGTACCATGGGTTATGTCATTGGATGTTATGGG) and a reverse primer with a SalI site (AAAGTCGACTCACGGTGGTCTCCATGCGAC). The product was cloned in frame behind the cT272-encoding sequence of pCI/cT272 vector (28) using KpnI/SalI.
pCI/SX and its derivates.
The XhoI/BglII fragment of HBV encoding the small HBsAg up to the HBV poly(A) sequence was cloned into the XhoI/BamHI-digested pCI vector to generate the pCI/SX plasmid. pCI/SX
int: the intron sequence was deleted from the pCI/SX vector by AflII restriction and religation to create pCI/SX
int. pCI/SX
P: the pCI/SX vector was digested with BglII/XhoI, blunted with Klenow, and religated to create the promoterless pCI/SX
P. pCI/S: pCI/SX plasmid was digested with XhoI/StuI, and the HBsAg-encoding fragment was cloned into XhoI/SmaI-digested pCI. pSI/SX: the HCMV promoter of pCI/SX vector was exchanged with the SV40 early promoter sequences derived from pSI vector (catalogue number E1712; Promega) to generate the plasmid pSI/SX. pCI/SXnonsense A: The pCI/SX vector was digested using NheI/XbaI and religated. This vector encodes the S42226 and the Pol386832 in an overlapping sequence. pCI/SXnonsense B: A HBV Pol fragment was amplified by PCR from the pCI/SX, using a forward primer with a NheI site (AAAGCTAGCGACGGAAATTGCACCTGTAT) and a reverse primer (CGAGAGAGTCCCAAGCGA). The product was cloned into NheI/BamHI cut pCI/SX vector. This vector encodes the S144226 and the Pol487832 in an overlapping sequence. pCI/SXnonsense C: An HBV pol fragment was amplified by PCR from the pCI/SX, using a forward primer with a NheI site (AAAGCTAGCCAAGTGTTTGCTGACGCAA) and a reverse primer (CGAGAGAGTCCCAAGCGA). The product was cloned into pCI/SX vector using NheI/BamHI. This vector encodes the Pol685832 sequence.
OVA-encoding plasmids: pCI/OVA. An OVA construct was generated that started at the methionine at OVA position 8 (for detail, see Swiss-Prot: OVAL_CHICK). The OVA8385-encoding sequence was amplified using a forward primer with a XhoI site (GGCTCGAGGCAGCAAGCATGGAATTTTG) and a reverse primer with a NotI site (GGGCGGCCGCTTAAGGGGAAACACATCTGCCAA). The product was cloned into pCI vector using XhoI/NotI to generate the pCI/OVA. pCI/cT-OVA1: An OVA18385-encoding fragment was amplified by PCR from the pCI/OVA plasmid, using a forward primer with a KpnI site (AAAGGTACCATTCAAGGAGCTCAAAGTCCACC) and a reverse primer with a NotI site (AAAGCGGCCGCTTAAGGGGAAACACATCTGCC). Compared with the wild-type OVA sequence, the forward primer contained one additional A nucleotide. The product was cloned into pCI/cT1272 vector to generate the pCI/cT-OVA1 construct. This construct encodes a fusion protein consisting of the cT1272 fragment and, mediated by the frame shift of the additional A nucleotide in the forward primer, 10 residues not related to OVA or large SV40 tumor Ag (T-Ag) (IQGAQSPPCQ), followed by a stop signal (cT + 10). Due to a start signal in the alternative reading frame, this construct additionally encodes an N-terminal 40-residue product not related to OVA or T-Ag (MILIQKKQRKLNKCPGSLVPFKELKVHHANENIFYCPIAI), followed by the OVA35385 fragment (OVA*). pCI/cT-OVA2: The OVA18385-coding fragment was amplified by PCR from the pCI/OVA plasmid using a forward primer with a KpnI site (AAAGGTACCATTCAAGGGCTCAAAGTCCACC) and a reverse primer with a NotI site (AAAGCGGCCGCTTAAGGGGAAACACATCTGCC). The product was cloned into pCI/cT1272 vector to generate the pCI/cT-OVA2 DNA. This construct expresses the cT1272/OVA18385 fusion protein plus 3-aa spacer (IQG) not related to T-Ag or OVA (cT-OVA).
Hepatitis B core Ag-encoding plasmid. The pCI/C DNA vaccine has been described (30).
Transient expression assays
Chicken hepatoma LMH cells (CRL-2117; American Type Culture Collection; Promochem) or human epithelial kidney HEK293 cells (CRL-1573; American Type Culture Collection; Promochem) were transiently transfected with plasmid DNA using the Ca2PO4 method, as described previously (28, 29). Where indicated, cells were labeled with [35S]methionine, extracted with lysis buffer, and immunoprecipitated using the anti-Pol mAb 9F9 (31), rabbit anti HBsAg serum, or anti-SV40 T-Ag mAb 419 and protein A-Sepharose. The precipitates were processed for SDS-PAGE, followed by fluorography. Alternatively, cellular extracts from unlabeled cells were directly processed for SDS-PAGE and analyzed by Western blotting using the anti-Pol mAb 9F9, polyclonal rabbit anti-SV40 T-Ag serum, or polyclonal anti-OVA serum (C-6534; Sigma-Aldrich), followed by 35S-labeled protein A (28, 29).
DNA vaccination
We injected 100 µg of DNA (50 µl of PBS containing 1 µg/µl plasmid DNA) into each tibialis anterior muscle, as described (32).
Peptides
Synthetic, HPLC-purified peptides used in the described experiments were obtained from Jerini BioTools.
Splenic specific CD8+ T cell frequencies
Spleen cells (1.5 x 107/ml) were incubated for 1 h in serum-free BioWhittaker-Ultra Culture medium (catalogue number BE12-725F; Cambrex Bio Science) with the indicated amounts of the specific or the control peptides. Thereafter, 5 µg/ml brefeldin A was added, and the cultures were incubated for further 4 h. Cells were harvested and surface stained with PE-conjugated anti-CD8 mAb (catalogue number 01045B; BD Pharmingen). Surface-stained cells were fixed with 2% paraformaldehyde in PBS before intracellular staining for IFN-
. Fixed cells were resuspended in permeabilization buffer (HBSS, 0.5% BSA, 0.5% saponin, and 0.05% sodium azide) and incubated with FITC-conjugated anti-IFN-
mAb (catalogue number 55441; BD Pharmingen) for 30 min at room temperature and washed in permeabilization buffer. Stained cells were resuspended in PBS/0.3% w/v BSA supplemented with 0.1% w/v sodium azide. We determined the frequencies of IFN-
+ CD8+ T cells by flow cytometry analyses. The mean numbers of IFN-
+ CD8+ T cells/105 CD8+ T cells are shown.
| Results |
|---|
|
|
|---|
The pCI/SX vector contains sequences encoding the small HBsAg (S) and its 3' untranslated sequence up to the HBV poly(A) sequence. It also contains in an overlapping, alternative ORF the sequence encoding the C-terminal Pol344832 fragment (Fig. 1, B and C). The nucleic acid sequence as well as the amino acid sequences of the alternative HBsAg- and Pol-specific ORFs for the pCI/SX DNA vaccine as well as the A2-restricted epitopes are shown in Fig. 2. The pCI/Pol vector encodes the 832 residue Pol protein, and the large HBsAg (LS) in an alternative reading frame (Fig. 1, B and C) (17). Cells transfected with pCI/SX plasmid DNA efficiently expressed (glycosylated and nonglycosylated) small HBsAg (S) (Fig. 1D). Cells transfected with the pCI/Pol vector expressed lower levels of the (glycosylated and nonglycosylated) large pre-S1/pre-S2/S (LS), middle pre-S2/S (MS), and small (S) HBsAg (Fig. 1D) (17). We did not detect expression of Pol or its fragments in cells transfected with either pCI/SX or pCI/Pol plasmid DNA using anti-Pol mAb 9F9 that binds an extreme C-terminal linear epitope with high affinity (Fig. 1D) (31).
An immunogenic Pol epitope is generated from a product translated from the alternative reading frame of the HBsAg-encoding expression plasmid pCI/SX
A2-tg mice were injected with the pCI/SX DNA vaccine. Spleen cells obtained from these mice 1214 days postvaccination were restimulated ex vivo with titrated amounts of the Pol- or HBsAg-derived peptides (Fig. 2B). The numbers of CD8+ T cells specifically inducible to IFN-
expression by each of the peptides were determined by flow cytometry. The pCI/SX DNA vaccine efficiently primed CD8+ T cell responses to the A2-restricted epitopes S1 and S2 of HBsAg and also to the Pol3 epitope of Pol (Fig. 3). This vaccine did not prime CD8+ T cell responses to the Pol1 and Pol2 epitope of Pol (Fig. 3). The pCI/Pol DNA vaccine (which coexpresses HBsAg and Pol from alternative reading frames) efficiently primed CD8+ T cell responses to the Pol1 and Pol3, but prime responses inefficiently to the Pol2 epitope and the HBsAg epitopes S1 and S2 (Fig. 3). CD8+ T cell responses to Pol3 were always higher than those to Pol1 (Fig. 3). Interestingly, the magnitude of the Pol3-specific T cell responses primed by either pCI/Pol (Pol3 epitope processed from the primary ORF) or pCI/SX (Pol3 epitope processed from the alternative ORF) was comparable (Fig. 3). Stimulation of splenic T cells ex vivo with titrated amounts of the different MHC-I-binding peptides of Pol reached saturating conditions when >2.5 x 107 M respective peptides were used (Fig. 3). Under these saturating conditions, CD8+ IFN-
+ T cell frequencies were comparable between the different groups. Control experiments confirmed the specificity of the responses to Pol and HBsAg. These responses did not cross-react to the C1 epitope of the control core Ag of HBV (Fig. 3). Similarly, vaccination with pCI/C (encoding the HBV core protein) induced a C1-specific CD8+ T cell response that did not cross-react with the Pol or HBsAg epitopes (Fig. 3). Thus, our data demonstrate that the Pol3 epitope can be efficiently processed from peptides generated from translation products of an alternative ORF.
|
T cell-stimulating epitopes generated from products translated from alternative ORFs have been identified in different experimental systems (4, 5, 6, 7, 8, 9, 10), but we report in this work the first example that it also operates in DNA vaccination. Sensitive CD8+ T cell priming/presentation assays have been used to detect expression of such cryptic protein products. Confirming this finding, we found strong T cell responses to the Pol3 epitope generated from products of alternative reading frames. But, it proved difficult to detect cryptic translation products in biochemical assays. We could not detect Pol fragments in lysates of metabolically labeled, pCI/SX-transfected cells using immunoprecipitation and/or Western blotting with the Pol-specific mAb 9F9 (Fig. 1D). Also, Pol expression was not detected in pCI/Pol-transfected cells using the same protocols (Fig. 1D) (17). These data show that Pol protein expression is difficult to detect. We cannot distinguish between low Pol expression and a high turnover rate of Pol. Hence, specific T cell priming by DNA vaccination is more a sensitive readout than most currently available biochemical tools to detect products from in-frame or out-of-frame transcription/translation.
We next asked whether stable overexpression of a Pol fragment enhances Pol3-specific T cell priming. The Pol585832 fragment encodes only the Pol3 epitope (but not the Pol1 or Pol2 epitope) (Figs. 1, B and C, and 2A). The heat shock protein 73 (hsp73)-facilitated expression system (28) was used to overexpress this Pol fragment. Its sequence was fused in frame behind the hsp73-capturing, DnaJ-homologous cT1272 protein domain derived from a cytosolic SV40 T-Ag variant. This generated the pCI/cT-Pol585832 DNA vaccine (Fig. 1C). The hsp73-bound cT-Pol585832 fusion protein was efficiently expressed in transfected cells and accumulated to high levels (Fig. 1D). A2-tg mice vaccinated with this DNA vaccine developed a Pol3-specific CD8+ T cell response. The magnitude of this response was comparable to that primed by DNA vaccines expressing Pol either in frame (pCI/Pol) or out of frame (pCI/SX) (Fig. 3). Thus, DNA vaccines with strikingly different levels of Pol expression prime Pol3-specific T cell responses with similar efficacy. The magnitude of Pol expression thus does not correlate with efficient generation of immunogenic epitopes. Rapid Pol degradation may make its detection of expression from pCI/Pol or pCI/SX difficult, but may facilitate the generation of immunogenic peptides.
Different HBsAg-encoding expression constructs support CD8+ T cell priming to the Pol3 epitope
We constructed variants of plasmid pCI/SX, tested their HBsAg expression, and measured their relative efficacy to prime A2-restricted T cell responses. We introduced the following deletions into the pCI/SX construct (Fig. 4A): deletion of C-terminal sequences encoding the Pol570832 sequence (construct 2: pCI/S); elimination of the intron between the promoter and the start codon of HBsAg (construct 3: pCI/SX
int); or elimination of the promoter (construct 5: pCI/SX
P). Furthermore, we exchanged HCMV-derived promoter sequences with SV40 promoter sequences (construct 4: pSI/SX). These constructs were tested for HBsAg expression (Fig. 4B). Efficient HBsAg expression was apparent from pCI/SX (lane 1) and pCI/S (lane 2). Expression of HBsAg was lower when the intron was deleted (pCI/SX
int; lane 3), or when the promoter sequences were changed (pSI/SX; lane 4), confirming previous results (32). No HBsAg expression was detected from the pCI/SX
P plasmid (lane 5). Pol-specific translation products were not detected in transfected cells (data not shown).
|
int, or pSI/SX DNA vaccines. The pCI/SX
P did not elicit S2-specific CD8+ T cell responses. CD8+ T cell responses to Pol3 were efficiently induced in mice by vaccination with pCI/SX or pCI/SX
int, but not with pCI/S, pCI/SX
P, or pSI/SX. HBsAg expression from HCMV-derived, but not SV40-derived promoter sequences thus supported generation of the immunogenic Pol3 epitope from a translation product of an alternative ORF. Intron sequences were not necessary for Pol3 priming. Expression constructs encoding Pol fragments in alternative and primary reading frames support Pol3-specific CD8+ T cell priming
Vaccinating mice with the pCI/SX DNA vaccine (encoding the Pol344832 fragment in an alternative ORF) primed CD8+ T cells specific for the Pol3, but not the Pol1 epitope (Fig. 3). A switch to the alternative ORF that generates the immunogenic Pol products may thus operate downstream of the position of the Pol1 epitope (Fig. 2A). To test whether immunogenic Pol3 peptides are translated from different cryptic or primary reading frames dependent on specific Pol sequences, we constructed pCI/SX-based nonsense vectors. The pCI/SXnonsense A vector was created by deleting the NheI/XbaI fragment (encoding the S-specific start codon) from the pCI/SX plasmid. The remaining sequence encodes the Pol386832 and S42226 fragments (Fig. 5A). Assuming that the first ATG motif is used to start translation, this construct may produce a S75226 fragment from the primary ORF and a Pol433832 fragment from an alternative ORF (Fig. 5A). Transient transfection followed by Pol-specific immunoprecipitation and/or Western blot analyses did not detect Pol or S fragments (data not shown), but a similar 174 deletion construct of HBsAg has been detected (33).
|
We further constructed the pCI/SXnonsense B vector containing the overlapping coding regions Pol487832 and S144226, and the pCI/SXnonsense C vector containing only the Pol685832-coding regions (Fig. 5A). These constructs did not express detectable levels of Pol or S (data not shown). Assuming that the first ATG motif is used to start translation, these constructs may produce the Pol506832 or Pol699832 proteins from the primary ORF (Fig. 5A). A2-tg mice vaccinated with these constructs generated high CD8+ T cell responses to Pol3 (Fig. 5B). Priming of Pol3-specific CD8+ T cells is comparable when translation products were generated from Pol fragments expressed from alternative ORFs (pCI/SX; pCI/SXnonsense A) or primary ORFs (pCI/SXnonsense B; pCI/SXnonsense C) (Fig. 5). The vector pCI/SXnonsense B encodes the S144226 sequence, but there is no ATG in this ORF preceding the S2 epitope (Fig. 5A). Hence, no S2-specific responses were primed with this construct.
Induction of OVA-specific CD8+ T cell responses
We extended the study to an unrelated Ag system using OVA. We compared generation of an immunogenic Kb-restricted OVA epitope from primary and an alternative translation product. We designed a pCI/cT-OVA1 expression plasmid that encodes the hsp73-binding cT1272 fragment and a 10-residue spacer IQGAQSPPCQ in the primary ORF (cT + 10; Fig. 6, A and B). This construct also encodes (in an alternative open reading frame) a fusion protein containing N terminally a 40-residue fragment MILIQKKQRKLNKCPGSLVPFKELKVHHANENIFYCPIAI initiated from an upstream ATG start signal and the OVA35385 (OVA*; Fig. 6, A and B). In the control pCI/cT-OVA2 construct, we inserted the OVA18385 sequence C terminally in frame to the cT1272 fragment to generate the cT-OVA18385 fusion protein (cT-OVA; Fig. 6, A and B). We further cloned a OVA8385 sequence into the pCI vector to generate the pCI/OVA construct (OVA; Fig. 6A). These constructs allowed the comparative evaluation of the immunogenicity of the Kb-restricted OVA257264 epitope SIINFEKL expressed from either the alternative (pCI/cT-OVA1) or primary (pCI/cT-OVA2, pCI/OVA) OVA-encoding ORFs. OVA-specific Western blotting revealed efficient expression of the OVA protein or the cT-OVA fusion protein by cells transfected with pCI/OVA or pCI/cT-OVA2 plasmid DNA (Fig. 6C). Cells transiently transfected with pCI/cT-OVA1 plasmid DNA efficiently expressed the N-terminal cT + 10 protein, but not the OVA* fragment, as expected (Fig. 6C).
|
| Discussion |
|---|
|
|
|---|
The HBsAg-encoding pCI/SX DNA vaccine efficiently primed CD8+ T cell responses to the A2-restricted epitopes S1 and S2 of HBsAg, and to the Pol3 epitope of Pol. Thus, T cell responses were efficiently primed by immunogenic translation products of in-frame and out-of-frame reading frames of a DNA vaccine. The Pol1 and Pol2 epitopes also encoded in this alternative reading frame were not primed by the pCI/SX vaccine (Fig. 3). The pCI/Pol DNA vaccine (expected to express the complete Pol) efficiently primed CD8+ T cell responses to the Pol3 and Pol1 epitopes. CD8+ T cell responses to Pol3 were always higher than those to Pol1 (Fig. 3). Binding affinities of the antigenic Pol and HBsAg peptides to HLA-A2 have been published and are in a similar range (1038 nM; Fig. 2B). It is considered that an affinity threshold of <500 nM is required for induction of CD8+ T cell responses (21). Thus, differences in the binding affinities of the antigenic peptides to their restricting element are unlikely to underlie the observed immunogenicity of Pol epitopes, focusing on the question as to how these epitopes are generated.
Conventional expression vectors used in DNA vaccines contain a transcription unit encoding the Ag sequence cloned downstream from a strong promoter/enhancer sequence that drives expression of the immunogenic protein from a primary reading frame. Promoter sequences used in DNA vaccines are often from viruses, e.g., CMV, SV40, or retroviruses (12). Our data suggest that the type of promoter used to express an Ag in a DNA vaccine has an influence on the efficacy of generating epitopes from alternative reading frames. HCMV-driven pCI/SX, but not SV40-driven pSI/SX DNA vaccines induced Pol3-specific T cell responses. Hence, HCMV-derived promoter sequences are apparently more efficient than SV40-derived promoter sequences in supporting generation of cryptic translation products from which immunogenic epitopes can be processed, but the molecular events underlying this finding are unclear. We have shown that DNA vaccines with SV40-derived promoter sequences produce lower levels of Ag from the primary reading frame than vaccines in which Ag expression is driven by HCMV-derived promoter sequences (Fig. 4B) (32). Thus, the efficacy of a promoter may play a role in the decreased generation of cryptic Pol-specific translation products. Alternatively, different promoter sequences may have different fidelities with which they use a primary reading frame.
We used different approaches to detect Pol-derived translation products from alternative reading frames using the anti-Pol mAb 9F9 directed against the extreme C terminus of Pol close to the location of the Pol3 epitope. We tried to detect newly synthesized Pol or Pol fragments in lysates of 35S-labeled transfectants or their steady state levels by Western blotting. We were only successful in detecting hsp73-associated cT-Pol585832 fusion Ag, but not in detecting the Pol protein nor any cryptic Pol fragments (Fig. 1D). Thus, Pol expression does not seem to correlate with efficient generation of immunogenic epitopes because apparently very different levels of Pol expression from DNA vaccines primed T cell responses in mice of comparable efficacy (Fig. 3). Rapid Pol degradation (that may make detection of its expression from pCI/Pol or the pCI/SX difficult) may facilitate the generation of immunogenic peptides from this protein, a finding compatible with the notion that degradation of nascent protein (but not the stability of mature proteins) is critical in generating MHC class I-binding epitopes (3).
We tested different expression constructs encoding HBsAg and Pol fragments from alternative reading frames of the same sequence. In the pCI/SXnonsense A construct, two reading frames apparently generated protein fragments that could not be detected by biochemical assays (Fig. 5). However, this nonsense construct induced CD8+ T cell responses to Pol and HBsAg. HCMV-derived promoter sequences can apparently initiate expression from different reading frames of the same sequence and generate products that can elicit CD8+ T cell responses in vivo (Fig. 5).
We assume that the first ATG motif is used to start translation and hence defines the primary reading frame. Different Pol constructs, encoding different N-terminal sequences of Pol (Pol344832, Pol386832, Pol487832, or Pol685832) in the primary or alternative reading frame, induced comparable Pol3 (Pol803811)-specific T cell responses (Fig. 5). Thus, the HCMV promoter is able to drive translation of immunogenic products from primary as well as alternative reading frames. We further confirmed efficient HCMV-driven generation of cryptic expression units with a DNA construct (pCI/cT-OVA1) encoding an SV40 T-Ag-derived cT + 10 protein in the primary reading frame and an OVA35385-encoding OVA* protein in an alternative ORF (Fig. 6). This construct elicited in B6 mice OVA-specific CD8+ T cell responses with an efficacy comparable to that of DNA constructs that encode OVA or the cT-OVA fusion protein (i.e., pCI/OVA or pCI/cT-OVA2). Thus, the HCMV promoter is able to drive translation of immunogenic products from an alternative OVA-encoding reading frame. The molecular mechanism underlying this observation is unknown. The phenomenon seems to have general importance. We demonstrated efficient use of alternative reading frames for the generation of immunogenic, T cell-stimulating epitopes in two unrelated and independent systems (HBV-Pol/S and OVA). It operated efficiently in two different cryptic ORFs, and was independent of intron sequences and of the level of protein translation from primary or alternative reading frames.
Generation of immunogenic epitopes from alternative reading frames is not restricted to viral Ag systems, but may be a feature intrinsic to the transcription or protein synthesis machinery (3). Experiments with OVA-encoding constructs confirmed the validity of the concept that out-of-frame translation products are a rich source of immunogenic epitopes, despite the fact that these translation products are not found by sensitive protein detection tools. This offers the chance to build an extended repertoire of antigenic information into multiple reading frames of synthetic genes delivered as DNA vaccines. But it also raises the question about the immunological definition of self: is self restricted to products of in-frame translation, or does it comprise epitopes generated by translating coding and noncoding sequences in all three reading frames? Can out-of-frame self induce autoimmunity? Can proinflammatory signals modulate the efficacy with which immunogenic epitopes are generated from out-of-frame translation products? The in vivo findings we report indicate innovative ways to construct T cell-stimulating vaccines, but also raise concerns about the possibility to concomitantly deliver self in an immunogenic form.
| Disclosures |
|---|
|
|
|---|
| Acknowledgments |
|---|
| Footnotes |
|---|
1 This work was supported by grants from the Deutsche Forschungsgemeinschaft (DFG Schi 505/2-2) (to R.S.) and the European Commission (QLK2-CT-2002-00700) (to J.R., A.B., and R.S.). ![]()
2 Address correspondence and reprint requests to Dr. Reinhold Schirmbeck, Institute for Medical Microbiology and Immunology, University of Ulm, Albert Einstein Allee 11, D-89081 Ulm, Germany. E-mail address: reinhold.schirmbeck{at}medizin.uni-ulm.de ![]()
3 Abbreviations used in this paper: ORF, open reading frame; HBsAg, hepatitis B surface Ag; HBV, hepatitis B virus; HCMV, human CMV; hsp, heat shock protein; LS, large HBsAg; MS, middle HBsAg; Pol, HBV polymerase; S, small HBsAg; T-Ag, large SV40 tumor Ag; tg, transgenic. ![]()
Received for publication August 2, 2004. Accepted for publication January 26, 2005.
| References |
|---|
|
|
|---|
This article has been cited by other articles:
![]() |
C. Li, K. Goudy, M. Hirsch, A. Asokan, Y. Fan, J. Alexander, J. Sun, P. Monahan, D. Seiber, J. Sidney, et al. Cellular immune response to cryptic epitopes during therapeutic gene transfer PNAS, June 30, 2009; 106(26): 10770 - 10774. [Abstract] [Full Text] [PDF] |
||||
![]() |
N. J. Maness, L. E. Valentine, G. E. May, J. Reed, S. M. Piaskowski, T. Soma, J. Furlott, E. G. Rakasz, T. C. Friedrich, D. A. Price, et al. AIDS virus specific CD8+ T lymphocytes against an immunodominant cryptic epitope select for viral escape J. Exp. Med., October 29, 2007; 204(11): 2505 - 2512. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. W. Yewdell and H. D. Hickman New lane in the information highway: alternative reading frame peptides elicit T cells with potent antiretrovirus activity J. Exp. Med., October 29, 2007; 204(11): 2501 - 2504. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. Schirmbeck, P. Riedl, M. Kupferschmitt, U. Wegenka, H. Hauser, J. Rice, A. Kroger, and J. Reimann Priming Protective CD8 T Cell Immunity by DNA Vaccines Encoding Chimeric, Stress Protein-Capturing Tumor-Associated Antigen J. Immunol., August 1, 2006; 177(3): 1534 - 1542. [Abstract] [Full Text] [PDF] |
||||
![]() |
O. Ho and W. R. Green Cytolytic CD8+ T Cells Directed against a Cryptic Epitope Derived from a Retroviral Alternative Reading Frame Confer Disease Protection J. Immunol., February 15, 2006; 176(4): 2470 - 2475. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |