|
|
||||||||


* Laboratory of Molecular Immunoregulation, Center for Cancer Research, and
Basic Research Program, Science Applications International Corporation-Frederick, National Cancer Institute, National Institutes of Health, Frederick, MD 21702; and
Laboratory of Parasitic Diseases, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Bethesda, MD 20892
| Abstract |
|---|
|
|
|---|
| Introduction |
|---|
|
|
|---|

T cells, and B cells (9, 11, 13, 14, 15, 16). LL-37 has also been detected in plasma, in bone marrow, and on the surface of airway and skin (11, 13, 17, 18). LL-37 is antimicrobial (3, 7, 13, 19) and can neutralize LPS (3, 7, 8, 20, 21). In recent years, LL-37 has been found to activate mast cells, phagocytes, and epithelial and endothelial cells (21, 22, 23); to induce the chemotaxis of phagocytes, T cells, and mast cells (24, 25); and to participate in wound healing (18, 26). We and others have previously demonstrated that LL-37 uses human formyl peptide receptor-like 1 (FPRL1), a G protein-coupled, seven-transmembrane domain receptor (27), as the receptor to mediate its chemotactic and angiogenic effects (23, 24).
In addition to LL-37, PR-39, a pig cathelicidin, has been shown to chemoattract and activate neutrophils (28). ProBac7, a bovine cathelicidin, is reported to be chemotactic for monocytes/macrophages (29). In mice, one cathelicidin, termed cathelin-related antimicrobial peptide (CRAMP), has been identified (30). Similar to LL-37, CRAMP has an
-helical structure (31), is antimicrobial in vitro and in vivo (18, 30, 32), and is angiogenic (23). However, whether CRAMP, similar to LL-37, also has direct effect on leukocytes is not known. In the present study we investigated the effect of CRAMP on both human and mouse leukocytes, particularly phagocytes, and found that CRAMP acted as a chemoattractant for leukocytes both in vitro and in vivo. In addition, we identified the receptor that CRAMP uses to mediate its effect on leukocytes. Furthermore, using OVA as an experimental Ag, we demonstrated that CRAMP has the capacity to enhance OVA-specific humoral and cellular immune responses when they were administered simultaneously, providing evidence to support the idea that vertebrate AMPs, including cathelicidins, can act as alarmins in response to danger signals and contribute to both innate and adaptive antimicrobial immunity of the host.
| Materials and Methods |
|---|
|
|
|---|
RPMI 1640 and DMEM were purchased from BioWhittaker. FBS was purchased from HyClone. Recombinant human GM-CSF (rhGM-CSF), IL-4 (rhIL-4), and macrophage-CSF (rhM-CSF) were purchased from PeproTech. Pertussis toxin (PTX) and fMLP were purchased from Sigma-Aldrich. MMK-1, an FPRL1-specific ligand of 13 amino acids (LESIFRSLLFRVM) (33), and W peptide, a chemotactic hexapeptide (WKYMVm, m represents a D-Met residue) originally identified from a combinatorial peptide library (34) and later found to be an agonistic ligand for human formyl peptide receptor (FPR) (35), FPRL1 (35), and FPRL2 (36, 37), were synthesized and purified at Colorado State University (Fort Collins, CO). CRAMP (ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE) and LL-37 ([LL-37, 37 aa]) were synthesized by solid phase F-moc chemistry and purified to >95% by reverse phase HPLC and electrospray ionization mass spectrometry analysis (Global Peptide Services).
Cell preparation and maintenance
Human PBMCs were isolated by Ficoll-Paque density gradient centrifugation from leukopacks supplied by the Department of Transfusion Medicine, Clinical Center of National Institutes of Health. Monocytes were purified (>95%) from PBMC using a MACS CD14 monocyte isolation kit (Miltenyi Biotec). Human neutrophils were isolated and purified to >99% as described previously (38). Mouse PBL were isolated from mouse peripheral blood by hemolysis with ACK lysing buffer (Quality Biological).
The generation of monocyte-derived macrophages and immature dendritic cells (iDCs) was conducted as described previously (39, 40). In brief, human monocyte-derived macrophages were generated by incubated purified monocytes at 1 x 106/ml in RPMI 1640 medium (RPMI 1640 containing 10% FBS, 2 mM glutamine, 25 mM HEPES, 100 U/ml penicillin, and 100 µg/ml streptomycin) in the presence of 50 ng/ml rhM-CSF at 37°C in a humidified CO2 (5%) incubator for 7 days. For the generation of iDCs, purified human monocytes were incubated at 1 x 106/ml in RPMI 1640 medium in the presence of 50 ng/ml rhGM-CSF and 50 ng/ml rhIL-4 at 37°C in a humidified CO2 (5%) incubator for 7 days. During the culture period, half the culture medium was replaced every 23 days.
Human embryonic kidney 293 (HEK293) cells stably expressing human FPRL1 (HEK293/FPRL1) or mouse formyl peptide receptor 2 (HEK293/mFPR2) were obtained from Dr. J. M. Wang (National Cancer Institute, Frederick, MD), which were originally gifts from Drs. P. M. Murphy and J.-L. Gao (National Institute of Allergy and Infectious Diseases, National Institutes of Health, Bethesda, MD). The parental HEK293 cells were maintained in complete DMEM (DMEM containing 10% FBS, 2 mM glutamine, 25 mM HEPES, 100 U/ml penicillin, and 100 µg/ml streptomycin). Both FPRL1/HEK293 and mFPR2/HEK293 cells were maintained in complete DMEM in the presence of 1 mg/ml G418 (Invitrogen Life Technologies).
Chemotaxis assay
Cell migration was assessed using a 48-well microchemotaxis chamber (NeuroProbe) as previously described (24, 39, 40). Briefly, various test factors diluted with chemotaxis medium (RPMI 1640 containing 1% BSA) were placed in the lower wells of the chamber, and the cells suspended in chemotaxis medium were added to wells of the upper compartment. The lower and upper compartments were separated by a piece of 5-µm pore size polycarbonate filter (NeuroProbe). For evaluating the migration of HEK293 cells, 10-µm pore size polycarbonate filters were coated at 37°C for 2 h with type 1 rat tail collagen (BD Biosciences) at a final concentration of 50 µg/ml, air-dried, and used. In some experiments, monocytes were pretreated for 1 h at 37°C in the absence or the presence of PTX (final concentration, 200 ng/ml) before use. For checkerboard analysis, CRAMP was simultaneously added to wells of the upper compartment. Incubation time varied depending on target cells (60 min for human neutrophils; 90 min for human monocytes, DCs, macrophages, and mouse PBLs; 300 min for HEK293 cells). After incubation, the filters were removed, scraped, and stained, and the number of cells migrating across the filter was counted using a BioQuant semiautomatic counting system (which objectively determines the average cell number of six defined microscopic fields) and presented as the number of cells per high power field.
Measurement of calcium flux
Monocytes were loaded by incubation with 5 µM fura 2 (Molecular Probes) at room temperature for 30 min in the dark. Subsequently, the cells were washed and resuspended at 1 x 106/ml in saline buffer (138 mM NaCl, 6 mM KCl, 1 mM CaCl2, 10 mM HEPES, 5 mM glucose, and 1% BSA, pH 7.4). Each 2 ml of loaded monocytes were transferred into a quartz cuvette, which was placed in a luminescence spectrometer (LS-50B; PerkinElmer). Calcium flux of the cells in response to chemotactic factors was measured by recording the ratio of fluorescence emitted at 510 nm after sequential excitation at 340 and 380 nm.
Detection of MAPK activation
Mouse PBLs and human PBMCs were washed three times with PBS and suspended in serum-free RPMI 1640. Cells (2 x 106/sample) were incubated at 37°C in the absence or the presence of the indicated concentrations of CRAMP for the specified period of time. At the end of the incubation, stimulation was immediately stopped by addition of large amount of ice-cold PBS (10-fold). The cells were centrifuged at 150 x g for 5 min at 4°C, washed with cold PBS, and lysed by SDS sample buffer (62.5 mM Tris-HCl (pH 6.8) at 25°C, 2% (w/v) SDS, 10% glycerol, 50 mM DTT, and 0.01% bromphenol blue). The lysates were sonicated for 10 s to shear DNA, boiled for 10 min, and cooled on ice. The lysates were loaded (20 µl/lane) and separated on a 412% NuPAGE bis-Tris gel using 1x NuPAGE MES SDS Running Buffer as the electrode buffer. SeeBlue Plus2 (Invitrogen Life Technologies) was used as a molecular size marker. After electrophoresis, proteins in the gel were electrotransferred (25 V constant for 1 h) onto a piece of Immobilon membrane (Millipore) using 1x NuPAGE transfer buffer (12 mM Tris, 96 mM glycine (pH 8.3), 0.1% (v/v) antioxidant, and 10% (v/v) methanol). Phosphorylated MAPKs were detected by Western blotting as previously described (41). In brief, the membrane was sequentially washed, blocked for 1 h at room temperature, washed, and incubated at 4°C overnight in the presence of a 1/1000 dilution of rabbit anti-phospho-p44/42 Ab (Cell Signaling Technology). On the next day, the membrane was washed and incubated with 1/2000 dilution of HRP-conjugated anti-rabbit IgG (Cell Signaling Technology) for 1 h. After washing and incubation with a working solution of ECL Plus Western Blotting Detection System (Amersham Biosciences) for 5 min at room temperature, the membrane was exposed to BioMax x-ray film (Eastman Kodak). The x-ray film was developed using an automatic processor (Kodak X-OMAT 200A). The same membrane was stripped and probed for p44/42 protein essentially in the same manner, except using rabbit anti-p44/42 Ab (Cell Signaling Technology) as the primary Ab.
Air pouch experiments
All mice were obtained from the animal production facility of the National Cancer Institute at Frederick and maintained under specific pathogen-free conditions in the experimental animal facility at the National Cancer Institute at Frederick for several weeks to allow acclimation before the experiments. The animal studies were conducted in accordance with the principles and procedures outlined in the National Institutes of Health Guide for the Care and Use of Animals. Air pouches were raised on the dorsum of 6- to 8-wk-old BALB/c mice as described previously (41). Mice with a well-formed air pouch were randomized into groups. Each mouse was injected with 1 ml of endotoxin-free PBS alone or PBS containing 0.4, 2, or 10 µM CRAMP into the air pouches. Four hours later, the mice were killed by CO2 asphyxiation, and cells in the air pouches were washed out with 3 ml of endotoxin-free PBS containing 5 mM EDTA and 20 U/ml heparin and enumerated after trypan blue staining. Differential counting of leukocyte subpopulations migrating into the pouch space was performed after eosin-methylene blue staining of cytospins.
Immunization and sample collection
Eight-week-old C57BL/6 mice were injected i.p. on day 1 with 0.2 ml of PBS containing 50 µg of OVA (Sigma-Aldrich) in the presence or the absence of CRAMP. Alum (Al(OH)3 gel; Sigma-Aldrich) was used as a positive control adjuvant. On day 14, all mice were booster-immunized by i.p. injection of 0.2 ml of PBS containing 50 µg of OVA. On days 10 and 21, blood samples were collected from each mouse by orbital bleeding. Serum was separated from each blood sample and used for measurement of the anti-OVA Ab titer. On day 21, all mice were euthanized, and their spleens were removed for the measurement of OVA-specific splenocyte proliferation and cytokine production.
ELISA for the quantitation of total and subclass OVA-specific IgG Ab
ELISA for the quantitation of total OVA-specific IgG in mouse serum was performed in the following steps with three to five washes in between steps. The solution used for dilution of samples and washing was PBS-containing 0.05% Tween 20 unless otherwise indicated. Step 1 involved coating 96-well ELISA plates and incubating cells with 10 µg/ml OVA in 0.05 M carbonate buffer (pH 9.5) at 4°C overnight. Step 2 consisted of blocking; the coated plates were incubated with PBS containing 1% skim milk for 1 h at 37°C. Step 3 involved reaction with samples or standard; serum samples or standard mouse anti-OVA IgG Ab (AntibodyShop) at various dilutions were added to wells of the coated plates that were subsequently incubated at 4°C overnight. In step 4, reaction with HRP-conjugated anti-mouse IgG was performed; HRP-conjugated goat anti-mouse IgG at the dilution of 1/1000 was added to wells of the plates and incubated for 1 h at 37°C. Step 5 involved reaction with HRP substrate and measurement of reaction product; 0.1 ml of 3,3',5,5'-tetramethylbenzidine substrate solution (Amersham Biosciences) was added to each well of the plates, which were incubated at room temperature for 15 min before the addition of 0.1 ml of 2 N H2SO4 and subsequently were measured spectrophotometrically using a Bio-Tek ELISA reader at a wavelength of 450 nm with a reference wavelength of 630 nm. The concentration of OVA-specific IgG in serum samples was calculated based on the standard curve.
The ELISA for measuring the subclass of OVA-specific IgG was performed similarly with minor modifications. After steps 13, 0.1 ml of diluted (1/1000) rabbit anti-mouse IgG1, IgG2a, IgG2b, or IgG3 (BD Pharmingen) was added to the plate and incubated at 4°C overnight before incubation with HRP-conjugated sheep anti-rabbit IgG. The level of anti-OVA IgG1, IgG2a, IgG2b, or IgG3 was illustrated as the reciprocal logarithmic value of the highest dilution that gave an absorbance
0.1 above the negative control value.
OVA-specific proliferation and cytokine-production of splenocytes
RBC-depleted splenocytes (3 x 105 cells/well) from each mouse were cultured in 96-well, flat-bottom plates in a final volume of 0.2 ml of complete RPMI 1640 medium (RPMI 1640 supplemented with 5% FBS, 2 mM glutamine, 25 mM HEPES, 100 U/ml penicillin, 100 µg/ml streptomycin, and 50 µM 2-ME) in the presence of OVA at various concentrations for 72 h at 37°C in humidified air containing 5% CO2. To measure the proliferation of splenocytes, cultures were pulsed for 16 h with 0.5 µCi/well [3H]thymidine and harvested, and the radioactivity incorporated into cells was measured using a microbeta counter (PerkinElmer Wallac). To determine cytokine production, the culture supernatants were collected and measured using a SearchLight technique (Pierce), which has a lower detection limit of 0.8 pg/ml for IL-4, 5.5 pg/ml for IL-6, 1.6 pg/ml for IL-10, and 7.8 pg/ml for IFN-
.
| Results |
|---|
|
|
|---|
First, we tested whether CRAMP could induce the migration of human PBMCs over a range of 1610,000 nM using LL-37 as a positive control. As shown in Fig. 1A, CRAMP induced monocyte migration in a dose-dependent manner. The peak response was observed at 400 nM. The synthesized CRAMP was >95% pure and had a mass identical with the calculated mass of CRAMP by mass spectrometry analysis (data not shown). To ensure that the monocyte-attracting activity of the CRAMP sample was not due to a potential nonpeptide contaminant, four aliquots of CRAMP sample were either treated or incubated for 30 min at 40°C in the absence or the presence of proteinase K or pronase and subsequently were diluted similarly and tested on monocytes isolated from the same donor. Digestion of CRAMP samples with either proteinase K or pronase almost completely abrogated the capacity of the CRAMP sample to induce the migration of human monocytes, indicating that the monocyte-attracting activity of the CRAMP sample was not due to a nonpeptide contaminant (Fig. 1B). To address whether CRAMP-induced migration of human monocytes was due to chemotaxis or chemokinesis, checkerboard analysis was performed (Table I). CRAMP, in a dose-dependent manner, induced the migration of human monocytes when added to the lower wells of the chemotaxis chamber. However, increasing concentrations of CRAMP added simultaneously with monocytes to the upper wells of the chamber abrogated monocyte migration induced by CRAMP in the lower wells. Thus, CRAMP-induced migration of monocytes was based on chemotaxis, rather than chemokinesis.
|
|
|
protein-coupled receptor (Gi
PCR)
To determine whether CRAMP-induced leukocyte chemotaxis was mediated by a Gi
PCR, we examined whether CRAMP-induced monocyte chemotaxis could be inhibited by PTX, a toxin that specifically inhibits Gi
PCR signaling by ADP-ribosylating the Gi
subunit of heterotrimeric G protein (42). Incubation of monocytes at 37°C for 30 min in the presence of PTX (200 ng/ml) before chemotaxis assay completely inhibited the migration of monocytes in response to CRAMP (Table II). Pretreatment with PTX did not affect the absolute motility of monocytes, because there was no difference in spontaneous migration between PTX-pretreated and control monocytes. Furthermore, the inhibition was not due to the preincubation per se, because control incubation of monocytes in the absence of PTX did not inhibit migration in response to CRAMP. As expected, fMLP-induced monocyte migration was also greatly inhibited by PTX. Therefore, CRAMP-induced monocyte chemotaxis seems to be mediated by a Gi
PCR.
|
PCR with its chemotactic agonistic ligands results in activation of MAPK in target cells (41, 43, 44). We investigated whether CRAMP could also induce the downstream activation of p44/42 MAPK in freshly isolated mouse PBLs by Western blotting (Fig. 3). PBS-treated mouse leukocytes display undetectable levels of phosphorylated p42 or p44 ERK (Fig. 3, lane 1, upper panel). Treatment with CRAMP enhanced the levels of phospho-p44/p42 in a dose- (Fig. 3, lanes 2, 4, and 6) and time (lanes 35)-dependent manner, with peak activation achieved 5 min after stimulation with 2 µM CRAMP (Fig. 3, upper panel). Probing the same membrane with anti-p44/42 Ab after stripping revealed the amount of p44/42 MAPK loaded on each lane (Fig. 3, lower panel), indicating no significant up-regulation of p44/42 MAPK proteins in response to CRAMP. In addition, CRAMP activated ERK MAPK in human monocytes (data not shown). These results supported the idea that CRAMP might act on leukocytes through a Gi
PCR.
|
To identify the chemotactic receptor for CRAMP, we investigated whether differentiation of monocytes to either DCs or macrophages (M
) would affect their responsiveness to CRAMP. Interestingly, monocyte-derived M
were still able to migrate chemotactically in response to CRAMP (Fig. 4A), whereas DCs differentiated from the same starting population of monocytes failed to migrate in response to CRAMP (Fig. 4B). The possibility that the failure of monocyte-derived DCs to migrate in response to CRAMP might have resulted from the inability of DCs to migrate was ruled out because the DCs migrated in response to W peptide, a chemoattractant known to be active on DCs (37, 39). Therefore, the Gi
PCR used by CRAMP must be a receptor that is functional in monocytes, neutrophils, and monocyte-derived M
, but is not functional in DCs derived from monocytes in vitro due to down-regulation of its responsiveness or expression.
|
PCRs based on published reports revealed a potential candidate, FPRL1, which is expressed by monocytes (27, 35, 40), neutrophils (27, 35), and monocyte-derived M
(40), but down-regulated on iDCs differentiated in vitro from monocytes (40). Additionally, LL-37, the human cathelicidin, has been shown to use FPRL1 as a receptor (23, 24). Because triggering FPRL1 on phagocytes results not only in chemotaxis, but also in Ca2+ flux (24, 39, 40), we investigated whether the capacity of CRAMP to induce Ca2+ flux in human monocytes could be homologously desensitized by an FPRL1-specific agonistic ligand, MMK-1 (33). As expected, both MMK-1 and CRAMP induced Ca2+ flux in monocytes in a dose-dependent manner (Fig. 5, A and B). In addition, the Ca2+ flux induced by CRAMP at 10 µM was completely desensitized by pretreatment of monocytes with 100 nM MMK-1 (Fig. 5C). Conversely, CRAMP at 10 µM markedly desensitized the Ca2+ flux in response to 5 nM MMK-1 (Fig. 5D). Because homologous cross-desensitization of Ca2+ flux is often due to two agonistic ligands acting on the same receptor, these data suggest that CRAMP indeed uses FPRL1 as a functional receptor.
|
PCRs did not migrate in response to CRAMP (data not shown). These results demonstrate that CRAMP acts as an agonistic ligand for FPRL1/mFPR2.
|
Having established that CRAMP acts as an agonistic ligand for FPRL1/mFPR2, we examined whether CRAMP could recruit leukocytes in vivo by the use of the mouse air pouch model. Injection of 1 ml of CRAMP or LL-37 diluted in LPS-free PBS (final concentration, 2 µM) into the experimentally formed air pouch of mice elevated the recruitment of leukocytes into the air pouch. Dilution of CRAMP to as low as 0.4 µM could induce a significant recruitment of leukocytes into mouse air pouches (Fig. 7B). Based on microscopic morphologies and differential counting, leukocytes recruited into the air pouch by CRAMP consisted predominantly of neutrophils, followed by monocytes and lymphocytes (Fig. 7C). These data demonstrate that CRAMP functions as a leukocyte chemoattractant in vivo.
|
Based on the multiple effects of AMPs on the migration and activation of various leukocytes, it has been proposed that AMPs such as defensins and cathelicidins, in addition to directly acting as innate antimicrobial effectors, may promote the induction of adaptive antimicrobial immune responses (5). Having established that CRAMP, similar to human cathelicidin/LL-37, acts as a chemoattractant and activator for leukocytes provided a basis for studies of experimental mouse model to determine whether cathelicidin has the capacity to enhance Ag-specific immune responses. To this end, B6 mice were immunized i.p. with OVA in the absence or the presence of CRAMP or alum (as a positive control) on day 1 and were boosted by i.p. injection of OVA alone on day 14. On days 10 and 21, the levels of anti-OVA-specific serum IgG were measured as an indicator of primary and secondary OVA-specific humoral immune responses, respectively. In addition, on day 21, the proliferation and cytokine production by mouse splenocytes in response to OVA stimulation were measured to determine the cellular anti-OVA immune response. As expected, immunization of OVA together with alum enhanced anti-OVA IgG Ab responses (Fig. 8A,
![]()
). CRAMP enhanced the anti-OVA IgG Ab response in a dose-dependent manner, with higher titers of serum anti-OVA IgG Ab induced by 40 than 10 nmol of CRAMP (Fig. 8A). Measurement of the subclass of anti-OVA-specific IgG in the serum samples of immunized mice revealed that the production of OVA-specific IgG1, IgG2a, IgG2b, and IgG3 was enhanced to various degrees by CRAMP (Fig. 8B). Although mice injected with OVA and 40 nmol of CRAMP showed moderate (statistically significant) enhancement of OVA-specific IgG1 during the primary anti-OVA immune response, there was no obvious selective enhancement of either IgG1 or IgG2a during the secondary anti-OVA immune response regardless of the dose of CRAMP administered (Fig. 8B). These data suggest that CRAMP, when administered i.p. together with OVA, enhanced the OVA-specific immune response without polarizing the immune response to either Th1 or Th2 dominance.
|
in response to the stimulation of 50 µg/ml OVA than did splenocytes from mice immunized with OVA alone (Fig. 8D). This enhancement of cytokine production by simultaneous immunization with CRAMP and OVA was also dose dependent. Because splenocytes from mice immunized with OVA plus CRAMP at 40 nmol produced both IL-4 and IFN-
in response to OVA stimulation, this supports the conclusion that CRAMP augmented both Th1- and Th2-type Ag-specific immune responses. | Discussion |
|---|
|
|
|---|
Most chemokines and chemoattractants show an optimal dose of
100 nM for chemoattracting leukocytes (27, 35, 39, 40, 47). The optimal dose of CRAMP to attract human and mouse leukocytes was
400 nM (Figs. 1, 2, 4, and 6). In vivo, maximal recruitment of mouse leukocytes by CRAMP when tested by an air pouch model was
2 µM (Fig. 7). This raises the question of whether a cathelicidin, such as CRAMP or LL-37, can reach a level of 2 µM in vivo. CRAMP is expressed by mouse granulocytes and skin keratinocytes, and its expression is up-regulated dramatically during the neonatal period and in response to skin injury or infection (18, 30, 32, 48). Although the expression of CRAMP in vivo has not been quantitatively measured, the expression of human cathelicidin, LL-37, by human airway epithelia in a human-mouse xenograft model has been determined to be 2 µg/ml, equivalent to 0.4 µM (19). The expression of LL-37 by keratinocytes in vitro can increase at both mRNA and protein levels by 10- to 50-fold in response to inflammatory stimuli (15, 49). Assuming that airway infection can also induce a 10- to 50-fold increase in cathelicidin (LL-37 or CRAMP) expression, the concentration of cathelicidin at the site of airway inflammation would reach 420 µM, sufficient for either LL-37 or CRAMP to participate in the recruitment of leukocytes to local inflammatory sites.
Although we showed that CRAMP was chemotactic for leukocytes in vitro and recruited leukocytes in vivo using a mouse air pouch model, it has been reported that there is no difference in neutrophil infiltration between wild-type and CRAMP knockout mice at the sites of skin bacterial infection (32). The lack of a deficiency in neutrophil recruitment at the skin infection sites of CRAMP knockout mice suggests that other chemoattractants or chemokines might have compensated for the lack of CRAMP in the skin infection model. Bacteria-derived, formylated peptides such as fMLP, complement product such as C5a, and certain chemokines such as IL-8 are all potent neutrophil recruiters (27). Such a scenario is not unique to CRAMP, because knockout of C5a receptor (50) or FPR (51) also did not reduce neutrophil recruitment into sites of bacterial infection.
To date, four members of the cathelicidin subfamily, including pig PR-39 (28), bovine ProBac7 (29), human LL-37 (14, 24, 25), and mouse CRAMP (the present study), have been shown to act as leukocyte chemoattractants. Although it remains to be determined whether PR-39 and ProBac7 also act as agonistic ligands for FPRL1/mFPR2-like orthologue receptors in corresponding species, it is tempting to speculate that cathelicidin-derived
-helical AMPs may function as a family of endogenous ligands for FPRL1/mFPR2-type receptors. For example, monkey cathelicidin/RL-37 is highly likely to be an agonist for FPRL1, because it has high homology with human cathelicidin/LL-37 (52) and can be recognized by anti-human cathelicidin/LL-37 Abs (53). In addition to cathelicidins, FPRL1/mFPR2-type receptors have been reported to host structurally diverse ligands ranging from big proteins including serum amyloid A, amyloid
42, a variety of small peptides derived from either host or pathogens, and even lipoxin A4, a lipid metabolite of eicosanoid (27, 35, 36, 46, 54, 55, 56, 57, 58); however, it is not known how these structurally diverse ligands interact with the same FPRL1/mFPR2-type receptor.
Activation of FPRL1/mFPR2 by agonistic ligands results in a Gi protein-coupled signaling cascade leading not only to chemotaxis of leukocytes, but also to increased adhesion, enhanced phagocytosis, and release of oxygen intermediates (27, 46, 54). Therefore, cathelicidin has been proposed to have the potential to promote innate and adaptive antimicrobial immunity by recruiting and activating leukocytes at sites of microbial invasion where it is present as a result of constitutive or induced production (4, 5, 6, 7). However, the in vivo evidence for such a role for cathelicidin in the induction of adaptive immune response has been lacking. The finding that mouse cathelicidin, CRAMP, similar to human cathelicidin, LL-37, is capable of inducing leukocyte activation and chemotaxis in vitro and in vivo (Figs. 17) enabled us to use mouse experimental models to address this issue. As a first step, we investigated whether CRAMP could enhance Ag-specific immune response to OVA, a commonly used experimental model Ag. The results showing that CRAMP, when simultaneously administered with OVA to B6 mice, dose-dependently enhanced OVA-specific Ab and T cell responses without polarizing the immune response to either Th1 or Th2 dominance, provided the first evidence demonstrating that cathelicidin has the capacity to promote the induction of an adaptive immune response.
How does cathelicidin promote Ag-specific antimicrobial immune responses? Cathelicidin is rapidly induced at the site of microbial invasion. The capacity of cathelicidin to promote the recruitment of monocytes (the present study and Refs. 24 and 29) would enhance the uptake, processing, and presentation of Ag because recruited monocytes can differentiate into DCs (the most potent APCs) (59, 60). This process may be facilitated by cathelicidin, because human cathelicidin/LL-37 has been reported to stimulate this differentiation process in vitro by up-regulating the endocytic capacity and surface expression of costimulatory molecules of DCs derived from monocytes (61). Furthermore, cathelicidin may enhance the induction of an adaptive immune response by promoting the production of CCL2/MCP-1 (21), a chemokine capable of recruiting monocytes, M
, and DCs, or facilitating the processing of IL-1
(62), an IL capable of enhancing Ag-specific immune responses. Additional investigation is needed to determine the relative contributions of these functional properties of cathelicidin to the enhancement of Ag-specific immune responses.
A number of structurally diverse, multifunctional, endogenous mediators of innate host defense, including defensins (63, 64, 65), eosinophil-derived neurotoxin (41, 66), high mobility group box 1 (67), aminoacyl-tRNA synthetases (68, 69), urokinase (70, 71), and ribosomal protein S19 (72), have been proposed to be categorized as endogenous immune alarmins based on the following criteria (66, 73). 1) They are rapidly induced or released in response to danger signals generated by tissue injury or various (viral, bacterial, fungal, or parasitic) forms of infection. 2) They can interact with GiPCRs, resulting in the recruitment of monocytes or DCs. 3) They can activate Ag-presenting leukocytes, such as monocytes or DCs, leading to the production of proinflammatory cytokines and/or maturation of DCs. Because the recruitment and subsequent activation of APCs are pivotal for the initiation of adaptive immune responses, these immune alarmins would contribute to rapid mobilization and activation of the innate and adaptive immune systems in response to danger signals. The demonstration that cathelicidin is capable of recruiting and activating APCs and enhancing Ag-specific immune responses (the present study and Refs. 24 and 61) indicates that cathelicidin is also an immune alarmin.
| Acknowledgments |
|---|
| Disclosures |
|---|
|
|
|---|
| Footnotes |
|---|
1 This work was supported in part by federal funds from the National Cancer Institute, National Institutes of Health, under Contract NO1-CO-12400. K.K. is supported in part by the Japan Society for the Promotion of Science, Program of Oversea Research Fellowships for Japanese Biomedical and Behavioral Researchers. The content of this publication does not necessarily reflect the views or policies of the Department of Health and Human Services, nor does mention of trade names, commercial products, or organizations imply endorsement by the U.S. government. The publisher or recipient acknowledges the right of the U.S. government to retain a nonexclusive, royalty-free license in and to any copyright covering the article. ![]()
2 Address correspondence and reprint requests to Dr. De Yang, Basic Research Program, Science Applications International Corp.-Frederick, Center for Cancer Research, National Cancer Institute, Building 560, Room 31-19, Frederick, MD 21702-1201. E-mail address: dyang{at}mail.ncifcrf.gov ![]()
3 Abbreviations used in this paper: AMP, antimicrobial protein; CRAMP, cathelin-related antimicrobial peptide; DC, dendritic cell; FPR, formyl peptide receptor; FPRL, FPR-like-1; Gi
PCR, Gi
protein-coupled receptor; hCAP18, human cationic antimicrobial protein of 18 kDa; HEK, human embryonic kidney; iDC, immature DC; M
, macrophage; mFPR2, mouse formyl peptide receptor-2; PTX, pertussis toxin; rh, recombinant human. ![]()
Received for publication November 16, 2004. Accepted for publication February 24, 2005.
| References |
|---|
|
|
|---|
-defensins are expressed by specific lymphocyte and monocyte populations. Blood 96: 3086-3093.
-defensin-1/2 and LL-37 on histamine release and prostaglandin D2 production from mast cells. Eur. J. Immunol. 31: 1066-1075.[Medline]
(SDF-1
) to CXCR4 chemokine receptor in normal human megakaryoblasts but not in platelets induces phosphorylation of mitogen-activated protein kinase p42/44 (MAPK), ELK-1 transcription factor and serine/threonine kinase AKT. Eur. J. Haematol. 64: 164-172.[Medline]
-helical antimicrobial peptide of the rhesus monkey. Antimicrob. Agents Chemother. 45: 2695-2702.
induces chemotaxis and oxidant stress by acting at formylpeptide receptor 2, a G protein-coupled receptor expressed in phagocytes and brain. J. Biol. Chem. 276: 23645-23652.
processing and release. J. Immunol. 172: 4987-4994.
-Defensins: Linking innate and adaptive immunity through dendritic and T cell CCR6. Science 286: 525-528.This article has been cited by other articles:
![]() |
R. D. Ye, F. Boulay, J. M. Wang, C. Dahlgren, C. Gerard, M. Parmentier, C. N. Serhan, and P. M. Murphy International Union of Basic and Clinical Pharmacology. LXXIII. Nomenclature for the Formyl Peptide Receptor (FPR) Family Pharmacol. Rev., June 1, 2009; 61(2): 119 - 161. [Abstract] [Full Text] [PDF] |
||||
![]() |
O. Soehnlein and L. Lindbom Neutrophil-derived azurocidin alarms the immune system J. Leukoc. Biol., March 1, 2009; 85(3): 344 - 351. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. W. Lisanby, M. K. Swiecki, B. L. P. Dizon, K. J. Pflughoeft, T. M. Koehler, and J. F. Kearney Cathelicidin Administration Protects Mice from Bacillus anthracis Spore Challenge J. Immunol., October 1, 2008; 181(7): 4989 - 5000. [Abstract] [Full Text] [PDF] |
||||
![]() |
Y. Morioka, K. Yamasaki, D. Leung, and R. L. Gallo Cathelicidin Antimicrobial Peptides Inhibit Hyaluronan-Induced Cytokine Release and Modulate Chronic Allergic Dermatitis J. Immunol., September 15, 2008; 181(6): 3915 - 3922. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. Di Nardo, K. Yamasaki, R. A. Dorschner, Y. Lai, and R. L. Gallo Mast Cell Cathelicidin Antimicrobial Peptide Prevents Invasive Group A Streptococcus Infection of the Skin J. Immunol., June 1, 2008; 180(11): 7565 - 7573. [Abstract] [Full Text] [PDF] |
||||
![]() |
G. de la Rosa, D. Yang, P. Tewary, A. Varadhachary, and J. J. Oppenheim Lactoferrin Acts as an Alarmin to Promote the Recruitment and Activation of APCs and Antigen-Specific Immune Responses J. Immunol., May 15, 2008; 180(10): 6868 - 6876. [Abstract] [Full Text] [PDF] |
||||
![]() |
E. Gaudreault and J. Gosselin Leukotriene B4 Induces Release of Antimicrobial Peptides in Lungs of Virally Infected Mice J. Immunol., May 1, 2008; 180(9): 6211 - 6221. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Yang, Q. Chen, S. B. Su, P. Zhang, K. Kurosaka, R. R. Caspi, S. M. Michalek, H. F. Rosenberg, N. Zhang, and J. J. Oppenheim Eosinophil-derived neurotoxin acts as an alarmin to activate the TLR2-MyD88 signal pathway in dendritic cells and enhances Th2 immune responses J. Exp. Med., January 21, 2008; 205(1): 79 - 90. [Abstract] [Full Text] [PDF] |
||||
![]() |
L. C. Huang, R. Y. Reins, R. L. Gallo, and A. M. McDermott Cathelicidin-Deficient (Cnlp / ) Mice Show Increased Susceptibility to Pseudomonas aeruginosa Keratitis Invest. Ophthalmol. Vis. Sci., October 1, 2007; 48(10): 4498 - 4508. [Abstract] [Full Text] [PDF] |
||||
![]() |
E. K. K. Tai, W. K. K. Wu, H. P. S. Wong, E. K. Y. Lam, L. Yu, and C. H. Cho A New Role for Cathelicidin in Ulcerative Colitis in Mice Experimental Biology and Medicine, June 1, 2007; 232(6): 799 - 808. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. Di Nardo, M. H. Braff, K. R. Taylor, C. Na, R. D. Granstein, J. E. McInturff, S. Krutzik, R. L. Modlin, and R. L. Gallo Cathelicidin Antimicrobial Peptides Block Dendritic Cell TLR4 Activation and Allergic Contact Sensitization J. Immunol., February 1, 2007; 178(3): 1829 - 1834. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Yang, Q. Chen, H. Yang, K. J. Tracey, M. Bustin, and J. J. Oppenheim High mobility group box-1 protein induces the migration and activation of human dendritic cells and acts as an alarmin J. Leukoc. Biol., January 1, 2007; 81(1): 59 - 66. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. S. Kornbluth and G. W. Stone Immunostimulatory combinations: designing the next generation of vaccine adjuvants J. Leukoc. Biol., November 1, 2006; 80(5): 1084 - 1102. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. G. Barlow, Y. Li, T. S. Wilkinson, D. M. E. Bowdish, Y. E. Lau, C. Cosseau, C. Haslett, A. J. Simpson, R. E. W. Hancock, and D. J. Davidson The human cationic host defense peptide LL-37 mediates contrasting effects on apoptotic pathways in different primary cells of the innate immune system J. Leukoc. Biol., September 1, 2006; 80(3): 509 - 520. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Pochet, S. Tandel, S. Querriere, M. Tre-Hardy, M. Garcia-Marcos, M. De Lorenzi, M. Vandenbranden, A. Marino, M. Devleeschouwer, and J.-P. Dehaye Modulation by LL-37 of the Responses of Salivary Glands to Purinergic Agonists Mol. Pharmacol., June 1, 2006; 69(6): 2037 - 2046. [Abstract] [Full Text] [PDF] |
||||
![]() |
Y. E. Lau, D. M. E. Bowdish, C. Cosseau, R. E. W. Hancock, and D. J. Davidson Apoptosis of Airway Epithelial Cells: Human Serum Sensitive Induction by the Cathelicidin LL-37 Am. J. Respir. Cell Mol. Biol., April 1, 2006; 34(4): 399 - 409. [Abstract] [Full Text] [PDF] |
||||
![]() |
S Rodriguez-Martinez, M E Cancino-Diaz, and J C Cancino-Diaz Expression of CRAMP via PGN-TLR-2 and of {alpha}-defensin-3 via CpG-ODN-TLR-9 in corneal fibroblasts. Br. J. Ophthalmol., March 1, 2006; 90(3): 378 - 382. [Abstract] [Full Text] [PDF] |
||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |