The JI PBL Intereron Source
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     
 


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Riedemann, N. C.
Right arrow Articles by Ward, P. A.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Riedemann, N. C.
Right arrow Articles by Ward, P. A.
The Journal of Immunology, 2004, 173: 1355-1359.
Copyright © 2004 by The American Association of Immunologists

Regulatory Role of C5a on Macrophage Migration Inhibitory Factor Release from Neutrophils1

Niels C. Riedemann2,*, Ren-Feng Guo2,*, Hongwei Gao*, Lei Sun*, Marco Hoesel*, Travis J. Hollmann{dagger}, Rick A. Wetsel{dagger}, Firas S. Zetoune* and Peter A. Ward3,*

* Department of Pathology, University of Michigan Medical School, Ann Arbor, MI 48109; and {dagger} Institute of Molecular Medicine for the Prevention of Human Disease, University of Texas, Houston, TX 77030


    Abstract
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
There is evidence that C5a and macrophage migration inhibitory factor (MIF) both play important roles in experimental sepsis. Humans with sepsis also show elevated levels of both mediators in the blood. Regulation of MIF during sepsis is poorly understood. We now demonstrate that neutrophil depletion greatly reduced serum MIF levels in rats and mice during the onset of sepsis after cecal ligation and puncture. In vitro, C5a induced MIF release from rat and mouse neutrophils. In vivo blockade of C5aR or absence of C5aR led to significantly reduced MIF generation during the onset of sepsis. C5a-induced release in vitro of MIF from neutrophils appeared to be due to up-regulation of MIF in cytoplasmic granules of neutrophils via activation of the protein kinase B signaling pathway together with involvement of PI3K. Our data suggest that C5a plays a role in enhancing MIF release from neutrophils in vitro and during sepsis. These findings represent a previously unrecognized function of C5a and neutrophils in the appearance of MIF in sepsis.


    Introduction
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Migration inhibitory factor (MIF)4 was originally described as a T cell product (1) and was later found to also be generated by pituitary cells (2), macrophages (3), eosinophils (4), tubular epithelial cells in kidney (5), and epithelial cells in lung (6). In earlier studies MIF was shown to activate T cells and induce proinflammatory cytokine production in macrophages (2, 3). MIF production by macrophages can be induced by low levels of glucocorticoids; MIF was found to override glucocorticoid-induced inhibition of proinflammatory cytokine production in monocytes (7). Such findings suggested a counter-regulatory role for MIF in the context of the effects of glucocorticoids, possibly explaining the proinflammatory potential of MIF. In addition, MIF knockout mice showed protection from p53-induced macrophage apoptosis (8), revealing a macrophage protective effect of MIF. Recent studies in septic rodents demonstrated that blockade of MIF up to 8 h after experimental induction of polymicrobial Gram-negative sepsis significantly improved survival (9). In the same study MIF was also found in the plasma of patients with severe sepsis and septic shock. The administration of MIF increased lethality after infusion of LPS (2, 10), whereas MIF knockout mice demonstrated improved survival after LPS challenge and showed reduced serum levels of TNF-{alpha} (10). In human sepsis, high MIF serum concentrations appear to correlate with bad outcomes (11). However, to date, there is little knowledge about regulation of MIF production during sepsis and the involvement of other cells, such as neutrophils, in MIF generation during sepsis.

There is now accumulating evidence that activation of the complement system occurs early during the onset of sepsis, with generation of the anaphylatoxin, C5a, which results in numerous harmful effects (reviewed in Ref. 12). C5a is a 74-aa protein that exerts various proinflammatory effects, such as chemotactic responses of neutrophils, release of granular enzymes, production by neutrophils of superoxide anion, vasodilatation, increased vascular permeability, and induction of thymocyte apoptosis during sepsis (reviewed in Ref. 12). Blockade of either C5a or C5aR leads to greatly improved survival in septic rodents (13, 14, 15). In humans, C5a is a serum marker that correlates with the severity of sepsis (16). During experimental sepsis, C5a compromises crucial innate immune functions of neutrophils, such as phagocytosis, chemotaxis, and generation of reactive oxygen species (13, 17). Recent work from our laboratory suggests that C5a may play a key role in the regulation of cytokine expression during sepsis (18). We now present evidence suggesting that C5a is able to cause release of MIF from neutrophils in vitro and during the onset of sepsis.


    Materials and Methods
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Reagents

Recombinant human C5a and other reagents were purchased from Sigma-Aldrich (St. Louis, MO).

Peptide synthesis and production of anti-C5aR Abs

A 37-aa peptide spanning the N terminus of the mouse C5aR (MDPIDNSSFEINYDHYGTMDPNIPADGIHLPKRQPGDC) was synthesized using an Applied Biosystems 430A peptide synthesizer (Foster City, CA). The peptide was then coupled to keyhole limpet hemocyanin by the glutaraldehyde method and used for the immunization of rabbits and the production of immunoreactive antisera. The anti-peptide-specific Ab was purified by affinity chromatography using the synthetic peptide coupled to cyanogen bromide-activated Sepharose 4B (Amersham Pharmacia Biotech, Piscataway, NJ).

Neutrophil isolation from whole blood and in vitro stimulation

Citrate was used as an anticoagulant (Baxter Health Care, Mundelein, IL) for the isolation of human neutrophils from blood, using Ficoll-Paque gradient centrifugation (Pharmacia Biotech, Uppsala, Sweden) followed by dextran sedimentation. Hypotonic RBC lysis was achieved using sterile H2O. Neutrophils were resuspended in DMEM (BioWhittaker, Walkersville, MD) containing 10% calf serum. A final concentration of 6 x 106 cells/ml was used for stimulation at 37°C for the times indicated with C5a (10–50 nM) or LPS (20 ng/ml), or both. Supernatant fluids were collected after pelleting the cells and were frozen at –80°C until used for ELISA analysis. For certain experiments neutrophils were preincubated for 30 min with 50 µM PI3K inhibitor LY294002 (Cell Signaling Technology, Beverly, MA), which inhibits phosphorylation of the protein kinase B (AKT) pathway.

Quantitation of MIF by ELISA

MIF levels in lysates of human neutrophils were determined using ELISA kits for human MIF (Chemicon International, Temecula, CA) according to the manufacturer’s instructions. Various dilutions for supernatant fluids from LPS-stimulated and LPS- plus C5a-stimulated neutrophils were analyzed. Also, companion ELISA tests were used for mouse and rat MIF in serum from animals that underwent cecal ligation and puncture (CLP).

Western blot analysis

Neutrophils were isolated from human blood and stimulated at 37°C in vitro with recombinant human C5a (10–50 nM), LPS (20 ng/ml), or both. Approximately 2 x 106 cells/condition were used for whole cell lysis using Laemmli buffer containing 5% ME. Lysates were separated on a NuPAGE 4–12% bis-Tris gel (Invitrogen, Carlsbad, CA), and proteins were transferred to a polyvinylidene difluoride membrane. Membranes were incubated overnight with Abs to phosphorylated and nonphosphorylated human/rat AKT (Cell Signaling Technology) or to MIF (Novus Biologicals, Littleton, CO). For detection of the protein, ECL Plus was used (Amersham Pharmacia Biotech, Piscataway, NJ) according to the manufacturer’s instructions.

MIF production in rats and in C5aR–/– mice

Specific, pathogen-free, 300-g, male Long-Evans rats or C57BL/6 mice (The Jackson Laboratory, Bar Harbor, ME) were used for all CLP studies. Anesthesia was achieved by i.p. injection of ketamine. In the CLP model (19), approximately one-third of the cecum in rats or two-thirds of the cecum in mice was ligated through a 3-cm abdominal midline incision. The ligated part of the cecum was punctured through and through with a 21-gauge needle. After repositioning of the bowel, the abdomen was closed in layers, using a 4.0 surgical suture (Ethicon, Somerville, NJ) and metallic clips. C5aR–/– mice and backcrossed littermate control mice (on the background of C57BL/6) were used. Where indicated, mice received 40 µg of anti-C5aR Ab i.v. in 200 µl of Dulbecco’s PBS solution immediately after CLP. Control animals received similar amounts of IgG Ab.

Neutrophil depletion in rats and mice

Neutrophil depletion was achieved using i.p. injection of rabbit anti-mouse neutrophil IgG or anti-rat neutrophil IgG (Accurate Chemicals & Scientific, Westbury, NY) 18 h before induction of CLP according to the manufacturer’s instructions. Control groups received equal amounts of normal rabbit serum by i.p. injection.

Collection of serum samples from septic animals

After induction of CLP, animals were killed at the indicated time points, and blood was drawn from the inferior caval vein. Blood samples were allowed to clot at 5°C for 6 h before centrifugation at 4000 rpm for 15 min at 4°C. Serum was collected and immediately frozen at –80°C until used for ELISA.

Immunocytochemistry and confocal microscopy

Human blood neutrophils were isolated as described above and plated on glass coverslips (no. 1 thickness, Fisher Scientific, Pittsburgh, PA) fastened to the bottom of punched-out wells on 12-well plates (diameter, 22.6 mm). Coverslips were sequentially coated with poly-D-lysine and calf skin collagen to promote cell adhesion. Neutrophils were incubated with LPS (20 ng/ml) and C5a (10 nM) for 4 h at 37°C, fixed in paraformaldehyde, and permeabilized with methanol. Intrinsic MIF was visualized with a mouse mAb to human MIF (1/1000 dilution; R&D Systems, Minneapolis, MN) and goat anti-mouse Alexa 568 (Molecular Probes, Eugene, OR) secondary Ab (1/1000 dilution) in the lissamine-rhodamine channel. Cells were imaged on an LSM 510 laser scanning confocal microscope (Zeiss, Oberkochen, Germany) with a x63 water immersion lens. In none of the original images in either channel were the intensities at the level of the saturation plateau.

Statistical analysis

All values were expressed as the mean ± SEM. Significance was assigned where p < 0.05. Datasets were analyzed using Student’s t test or one-way ANOVA, with individual group means being compared with the Student-Newman-Keuls multiple comparison test.


    Results
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Effects of C5a and LPS on MIF production in neutrophils

To investigate the ability of C5a and LPS to induce MIF release, human neutrophils were isolated from blood. The neutrophil content in the preparations was >95% of all cells present based on differential staining with Wright’s stain. The cells were incubated for 6 h in vitro with C5a (10 nM), LPS (20 ng/ml), or both. ELISA measurements on neutrophil supernatant fluids were then conducted. The results in Fig. 1A demonstrate that incubation of human neutrophils for 4 h with human C5a or LPS resulted in significant MIF release. When neutrophils were costimulated with both C5a and LPS, incremental MIF release was observed. Western blot experiments with neutrophils using whole cell lysates from similarly treated cells revealed that incubation of neutrophils with C5a, LPS, or both in all cases resulted in increases in cellular MIF (Fig. 1B). Similar results were obtained with experiments using rat neutrophils (data not shown).



View larger version (16K):
[in this window]
[in a new window]
 
FIGURE 1. C5a- and LPS-induced in vitro release of MIF from human neutrophils. A, ELISA measurements of MIF in neutrophil supernatant fluids. Neutrophils were isolated from blood and incubated in vitro with C5a (50 nM), LPS (20 ng/ml), or their combination for 6 h at 37°C at a concentration of 6 x 106 cells/ml. Ctrl, culture medium alone. The asterisks indicates statistical significant difference from the reference group (*) or from all other groups (**). Data are representative of four independent and separate experiments. Incubation and analysis were conducted in separate, quadruplicate samples. B, Western blot measurements of MIF content in whole cell lysates from human neutrophils incubated similar to cells in A. Equal loading conditions were suggested by GAPDH content. Data are representative of three independent experiments.

 
MIF expression in isolated neutrophils was also determined by immunostaining and confocal microscopy. Neutrophils were treated with the combination of LPS and C5a for 4 h under the conditions described above. Cells were fixed and permeabilized, and immunofluorescence was used to visualize intracellular MIF. As shown in Fig. 2, MIF was faintly present in a granular pattern in the cytoplasm (red staining; Fig. 2B). In striking contrast, cells treated with LPS and C5a showed much stronger staining in virtually all cells, exhibiting a granular pattern in the cytoplasm (Fig. 2D). Given the fact that the purity of neutrophils in the isolated cells was >95%, and because of the polymorphonuclear pattern in phase contrast microscopy of the positively staining cells (Fig. 1, A and C), we conclude that neutrophils are the major source of MIF in supernatant fluids of cell cultures and that the source of MIF cannot be related to the small (<5%) contamination by monocytes or eosinophils. In addition, the robust increase in MIF in cells treated with C5a and LPS suggests transcriptional up-regulation of MIF (Figs. 1B and 2D).



View larger version (44K):
[in this window]
[in a new window]
 
FIGURE 2. Confocal microscopy of MIF in neutrophils. Neutrophils were isolated from human blood in the usual manner and incubated in vitro with C5a (50 nM), LPS (20 ng/ml), or the combination for 4 h at 37°C. Cellular MIF was visualized with anti-MIF Ab and goat anti-mouse Alexa 568 secondary Ab in the lissamine-rhodamine channel. Control neutrophils and activated cells were viewed under phase microscopy (A and C) and under the rhodamine channel (B and D).

 
Effects of neutrophil depletion on serum levels of MIF after CLP

ELISA experiments performed on serum samples from rats at various times after CLP revealed that MIF was released into the serum early during the onset of sepsis, reaching a plateau at 6 h (Fig. 3A). Similar findings were obtained in serum from CLP mice (data not shown). To investigate the potential contribution of neutrophils to MIF release after CLP, we depleted rats of neutrophils with an anti-neutrophil Ab, which was injected 18 h before CLP. Compared with the control group, which received an irrelevant IgG Ab, neutrophil-depleted animals showed substantially lower levels (by 58%; p < 0.05) of MIF in the serum 6 h after CLP (Fig. 3B). Similar experiments were conducted in mice and also showed that neutrophil-depleted animals demonstrated significantly reduced serum levels (by 81%) of MIF 6 h after CLP (Fig. 3C). These results suggest the requirement for neutrophils in MIF generation during the early period of sepsis in rodents, although a contribution from eosinophils cannot be ruled out.



View larger version (18K):
[in this window]
[in a new window]
 
FIGURE 3. Participation of neutrophils in MIF appearance in serum. A, ELISA analysis for MIF in rat serum at various time points after CLP. Data are representative of four to six different serum samples per group. B, ELISA analysis of MIF in serum samples obtained from neutrophil-depleted and neutrophil-intact rats 6 h after CLP. Neutrophil depletion was achieved by i.p. injection of anti-neutrophil Ab 18 h before CLP. Data are representative of five animals per group. C, ELISA analysis of MIF in mouse serum samples 6 h after CLP in neutrophil-depleted mice and mice treated with normal rabbit IgG. Data are representative of five animals per group. *, Statistically significant difference from the reference group.

 
Requirement for C5aR in MIF release during sepsis

To investigate whether the observed effects of C5a on MIF release from neutrophils in vitro had an in vivo parallel, we subjected C5aR–/– mice and C5aR+/+ mice to CLP and conducted ELISA measurements on serum samples obtained 6 h after CLP. The results demonstrated that the genetic absence of C5aR resulted in significantly reduced (by 55%) MIF appearance in serum during the early onset of CLP-induced sepsis in mice (Fig. 4A). To extend these findings, we conducted experiments in which C5aR+/+ mice were injected i.v. with anti-C5aR Ab or irrelevant IgG at the start of CLP. Six hours after CLP, mice treated with anti-C5aR Ab demonstrated significantly less (65%) MIF than mice treated with irrelevant IgG Ab (Fig. 4B).



View larger version (13K):
[in this window]
[in a new window]
 
FIGURE 4. Requirement for C5aR in generation of MIF during sepsis. A, ELISA analysis of MIF in serum samples from C5aR–/– and C5aR +/+ mice 6 h after CLP. Data are representative of five different animals per group. B, ELISA analysis of MIF in serum samples from C57BL/6 mice treated with either 40 µg of anti-C5aR Ab or an equivalent amount of irrelevant IgG (n = 4/group). *, Statistically significant difference from the wild-type or control IgG group.

 
Evidence for involvement of AKT and PI3K in release of MIF from activated neutrophils

We investigated the ability of C5a to induce phosphorylation of the AKT signaling pathway in human neutrophils using Western blot techniques applied to whole cell lysates from human neutrophils. C5a caused rapid phosphorylation of AKT, within 5 min of in vitro incubation with 10 nM C5a (Fig. 5A). This activation appeared to be transient, because it was greatly diminished at 15 min and beyond. In contrast, incubation of neutrophils with 20 ng/ml LPS did not result in phosphorylation of AKT after 5 min of incubation, whereas faint phosphorylation of AKT could be detected after 30 min of incubation with LPS. With the combination of LPS and C5a, strong phosphorylation of AKT was noted at 5 min, with loss of phosphorylation at 15 min and faint, but discernible, phosphorylation at 30 min, similar to the pattern found with C5a alone.



View larger version (31K):
[in this window]
[in a new window]
 
FIGURE 5. C5a-induced release of MIF from neutrophils and associated AKT activation. A, Western blot analysis of AKT activation (phosphorylation) in whole cell lysates of human neutrophils stimulated for various times (as depicted) at 37°C with tissue culture fluid (Ctrl) and with C5a (50 nM), LPS (20 ng/ml), or both. The blots are representative of two or three independent experiments. B, ELISA for MIF in neutrophil supernatant fluids. Neutrophils (6 x 106 cells/ml) were pretreated with either the PI3K inhibitor LY294002 (50 µM) or control buffer for 30 min before stimulation for 6 h at 37°C with C5a (50 nM), LPS (20 ng/ml), or both. *, Statistically significant difference from the reference (ctrl) group; **, significant statistical difference from all other groups. C, Western blot analysis of AKT activation (phosphorylation) in whole cell lysates of neutrophils pretreated and stimulated for 5 min as described in B. Data are representative of three independent experiments. The PI3K inhibitor was used as described in B.

 
To investigate whether AKT activation was involved in C5a- or LPS-induced release of MIF from neutrophils, we conducted in vitro experiments in which human neutrophils were preincubated with 50 µM PI3K inhibitor for 30 min. This inhibitor blocks the activation of the kinase (PI3K) upstream of AKT. The cells were subsequently stimulated with C5a (10 nM), LPS (20 ng/ml), or both for 6 h at 37°C (Fig. 5B) or for 5 min for Western blot determinations (pAKT; Fig. 5C). The results presented in Fig. 5B demonstrate that preincubation of neutrophils with PI3K inhibitor almost totally inhibited the C5a- or LPS-induced (or their combination) release of MIF. Furthermore, C5a-induced AKT phosphorylation in neutrophils was completely abolished in the presence of the PI3K inhibitor (Fig. 5C). Our data suggest that C5a- and LPS-induced release of MIF from neutrophils is regulated by activation of the AKT (and the PI3K) signaling pathways, which has not previously been described.


    Discussion
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Neutrophils have received little attention as a source of MIF. In a model of gastric ulcer formation in rats, macrophages were thought to be the major source of MIF (20). Our data suggest that neutrophils are one of the important sources for MIF and may play an important role in MIF release during the onset of experimental sepsis. Our findings are especially interesting, because to date there is little information about the source(s) and regulatory mechanism(s) for MIF appearance during the onset of experimental sepsis. It has been suggested that the pituitary gland may be a major source of MIF generation after endotoxin infusion into rodents (2).

The current studies demonstrate that LPS and C5a significantly induce MIF release from neutrophils. As shown in Fig. 2, little MIF was observed in nonstimulated cells. The small amount detectable was found in cytoplasmic granules of neutrophils. In contrast, neutrophils exposed to LPS and C5a evoked very strong immunostaining for MIF (Fig. 2D), implying that the release of MIF from neutrophils was probably due to transcriptional up-regulation. LPS is known to enhance MIF generation in macrophages (3), and MIF may be specifically generated in response to Gram-negative infections. MIF knockout mice showed reduced ability to clear Leishmania major due to impaired macrophage function (21) and had a greater susceptibility to Salmonella typhimurium infection (22). In contrast, Gram-positive exotoxins have been shown to be potent inducers of MIF production in macrophages; also, anti-MIF Abs protect mice from lethal Gram-positive exotoxin challenge (23). MIF has been demonstrated to play a crucial role in LPS-induced lung injury (24) and in noninfectious acute pancreatitis (25). Interestingly, recent findings suggest that MIF may be involved in the regulation of TLR expression (26), which suggests an important feedback mechanism for MIF and LPS.

Recently, we have found in vitro that C5a negatively regulates LPS-induced release of TNF-{alpha} by neutrophils, but has the opposite effect on TNF-{alpha} release from alveolar macrophages (18). In the same study, treatment of CLP mice with anti-C5a caused enhanced serum levels of TNF-{alpha} and protected the signaling pathways in neutrophils from C5a-induced dysfunction. In addition, C5aR–/– mice or wild-type mice treated with anti-C5aR at the onset of sepsis had decidedly lower levels of MIF in serum and had much lower lethality (Fig. 4). Previous as well as the current data suggest that neutrophils may be an important source of TNF-{alpha} and MIF during sepsis. C5a enhances MIF release from neutrophils in vitro (Fig. 1), C5aR is clearly required for sepsis-induced generation of MIF. As shown in Fig. 3, neutrophil-depleted animals demonstrated significantly reduced serum levels of MIF 6 h after CLP. MIF can be strongly induced in neutrophils (Fig. 2), suggesting that neutrophils may be an important source of MIF during sepsis. In addition, it is possible that other neutrophil products (e.g., TNF-{alpha}) might promote the release of MIF from other cell types, such as macrophages. The extent to which eosinophils and monocytes contribute to the appearance of MIF in serum during sepsis is not known.

The intracellular mechanisms leading to MIF generation in various cell types are inadequately understood, although activation of the transcription factor NF-{kappa}B is presumed to be involved in MIF generation in macrophages. As for the mechanism for C5a-induced MIF generation in neutrophils, our data implicate activation of the AKT pathway via phosphorylation by PI3K as an important signaling pathway (Fig. 5). Activation of the AKT pathway in neutrophils by C5a has been reported to delay apoptosis (27), and G protein-coupled PI3K{gamma} was demonstrated to be involved in chemotaxis and the oxidative burst in neutrophils (28, 29). LPS-induced release of MIF from neutrophils appears also to be dependent on AKT activation, whereas LPS alone only poorly induced phosphorylation of AKT. It is possible that LPS induces AKT phosphorylation at much later time points.

In conclusion, our data suggest that C5a acts as a major regulator for MIF release from neutrophils by activating the AKT signaling pathway. Neutrophils may be an important and previously unrecognized source of MIF generation during the onset of sepsis. Our findings suggest important interactions between two important proinflammatory mediators (C5a and MIF) during the onset of sepsis.


    Footnotes
 
1 This work is supported by National Institutes of Health, National Heart, Lung, and Blood Institute Grants GM29507, HL31963, and GM61656. Back

2 N.C.R. and R.-F.G. contributed equally to this work. Back

3 Address correspondence and reprint requests to Dr. Peter A. Ward, Department of Pathology, University of Michigan Medical School, 1301 Catherine Road, Ann Arbor, MI 48109-0602. E-mail address: pward{at}umich.edu Back

4 Abbreviations used in this paper: MIF, macrophage migration inhibitory factor; CLP, cecal ligation and puncture; AKT, protein kinase B. Back

Received for publication February 9, 2004. Accepted for publication May 6, 2004.


    References
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 

  1. David, J. R.. 1966. Delayed hypersensitivity in vitro: its mediation by cell-free substances formed by lymphoid cell-antigen interaction. Proc. Natl. Acad. Sci. USA 56:72.[Free Full Text]
  2. Bernhagen, J., T. Calandra, R. A. Mitchell, S. B. Martin, K. J. Tracey, W. Voelter, K. R. Manogue, A. Cerami, R. Bucala. 1993. MIF is a pituitary-derived cytokine that potentiates lethal endotoxaemia. Nature 365:756.[Medline]
  3. Calandra, T., J. Bernhagen, R. A. Mitchell, R. Bucala. 1994. The macrophage is an important and previously unrecognized source of macrophage migration inhibitory factor. J. Exp. Med. 179:1895.[Abstract/Free Full Text]
  4. Rossi, A. G., C. Haslett, N. Hirani, A. P. Greening, I. Rahman, C. N. Metz, R. Bucala, S. C. Donnelly. 1998. Human circulating eosinophils secrete macrophage migration inhibitory factor (MIF): potential role in asthma. J. Clin. Invest. 101:2869.[Medline]
  5. Rice, E. K., G. H. Tesch, Z. Cao, M. E. Cooper, C.N. Metz, R. Bucala, R. C. Atkins, D. J. Nikolic-Paterson. 2003. Induction of MIF synthesis and secretion by tubular epithelial cells: a novel action of angiotensin II. Kidney Int. 63:1265.[Medline]
  6. Arndt, U., G. Wennemuth, P. Barth, M. Nain, Y. Al-Abed, A. Meinhardt, D. Gemsa, M. Bacher. 2002. Release of macrophage migration inhibitory factor and CXCL8/interleukin-8 from lung epithelial cells rendered necrotic by influenza A virus infection. J. Virol. 76:9298.[Abstract/Free Full Text]
  7. Calandra, T., J. Bernhagen, C. N. Metz, L. A. Spiegel, M. Bacher, T. Donnelly, A. Cerami, R. Bucala. 1995. MIF as a glucocorticoid-induced modulator of cytokine production. Nature 377:68.[Medline]
  8. Mitchell, R. A., H. Liao, J. Chesney, G. Fingerle-Rowson, J. Baugh, J. David, R. Bucala. 2002. Macrophage migration inhibitory factor (MIF) sustains macrophage proinflammatory function by inhibiting p53: regulatory role in the innate immune response. Proc. Natl. Acad. Sci. USA 99:345.[Abstract/Free Full Text]
  9. Calandra, T., B. Echtenacher, D. L. Roy, J. Pugin, C. N. Metz, L. Hultner, D. Heumann, D. Mannel, R. Bucala, M. P Glauser. 2000. Protection from septic shock by neutralization of macrophage migration inhibitory factor. Nat. Med. 6:164.[Medline]
  10. Bozza, M., A. R. Satoskar, G. Lin, B. Lu, A. A. Humbles, C. Gerard, J. R. David. 1999. Targeted disruption of migration inhibitory factor gene reveals its critical role in sepsis. J. Exp. Med. 189:341.[Abstract/Free Full Text]
  11. Gando, S., J. Nishihira, S. Kobayashi, Y. Morimoto, S. Nanzaki, O. Kemmotsu. 2001. Macrophage migration inhibitory factor is a critical mediator of systemic inflammatory response syndrome. Intens. Care Med. 27:1187.[Medline]
  12. Riedemann, N. C., R. F. Guo, P. A. Ward. 2003. Novel strategies for the treatment of sepsis. Nat. Med. 9:517.[Medline]
  13. Huber-Lang, M. S., N. C. Riedeman, J. V. Sarma, E. M. Younkin, S. R. McGuire, I. J. Laudes, K. T. Lu, R. F. Guo, T. A. Neff, V. Padgaonkar, et al 2002. Protection of innate immunity by C5aR antagonist in septic mice. FASEB J. 16:1567.[Abstract/Free Full Text]
  14. Riedemann, N. C., R. F. Guo, T. A. Neff, I. J. Laudes, K. A. Keller, V. J. Sarma, M. M. Markiewski, D. Mastellos, C. W. Strey, C. L. Pierson, et al 2002. Increased C5a receptor expression in sepsis. J. Clin. Invest. 110:101.[Medline]
  15. Czermak, B. J., V. Sarma, C. L. Pierson, R. L. Warner, M. Huber-Lang, N. M. Bless, H. Schmal, H. P. Friedl, P. A. Ward. 1999. Protective effects of C5a blockade in sepsis. Nat. Med. 5:788.[Medline]
  16. Nakae, H., S. Endo, K. Inada, T. Takakuwa, T. Kasai, M. Yoshida. 1994. Serum complement levels and severity of sepsis. Res. Commun. Chem. Pathol. Pharmacol. 84:189.[Medline]
  17. Guo, R. F., N. C. Riedemann, K. D. Bernacki, J. V. Sarma, I. J. Laudes, F. S. Zetoune, J. Reuben, E. M. Younkin, T. A. Neff, J. D. Paulaskis, et al 2003. Neutrophil C5a receptor and the outcome in a rat model of sepsis. FASEB J. 13:1889.
  18. Riedemann, N. C., R. F. Guo, K. D. Bernacki, J. Reuben, I. J. Laudes, T. A. Neff, H. Gao, C. Speyer, J. V. Sarma, F. S. Zetoune, et al 2003. Regulation by C5a of neutrophil activation during sepsis. Immunity 19:193.[Medline]
  19. Guo, R. F., M. Huber-Lang, X. Wang, V. Sarma, V. A. Padgaonkar, R. A. Craig, N. C. Riedemann, S. D. McClintock, T. Hlaing, M. M. Shi, et al 2000. Protective effects of anti-C5a in sepsis-induced thymocyte apoptosis. J. Clin. Invest. 106:1271.[Medline]
  20. Huang, X. R., C. W. Chun Hui, Y. X. Chen, B. C. Wong, P. C. Fung, C. Metz, C. H. Cho, W. M. Hui, R. Bucala, S. K. Lam, et al 2001. Macrophage migration inhibitory factor is an important mediator in the pathogenesis of gastric inflammation in rats. Gastroenterology 121:619.[Medline]
  21. Satoskar, A. R., M. Bozza, M. Rodriguez Sosa, G. Lin, J. R. David. 2001. Migration-inhibitory factor gene-deficient mice are susceptible to cutaneous Leishmania major infection. Infect. Immun. 69:906.[Abstract/Free Full Text]
  22. Koebernick, H., L. Grode, J. R. David, W. Rohde, M. S. Rolph, H. W. Mittrucker, S. H. Kaufmann. 2002. Macrophage migration inhibitory factor (MIF) plays a pivotal role in immunity against Salmonella typhimurium. Proc. Natl. Acad. Sci. USA 99:13681.[Abstract/Free Full Text]
  23. Calandra, T., L. A. Spiegel, C. N. Metz, R. Bucala. 1998. Macrophage migration inhibitory factor is a critical mediator of the activation of immune cells by exotoxins of Gram-positive bacteria. Proc. Natl. Acad. Sci. USA 95:11383.[Abstract/Free Full Text]
  24. Lai, K. N., J. C. Leung, C. N. Metz, F. M. Lai, R. Bucala, H. Y. Lan. 2003. Role for macrophage migration inhibitory factor in acute respiratory distress syndrome. J. Pathol. 199:496.[Medline]
  25. Fingerle-Rowson, G., P. Koch, R. Bikoff, X. Lin, C. N. Metz, F. S. Dhabhar, A. Meinhardt, R. Bucala. 2003. Regulation of macrophage migration inhibitory factor expression by glucocorticoids in vivo. Am. J. Pathol. 162:47.[Abstract/Free Full Text]
  26. Roger, T., J. David, M. P. Glauser, T. Calandra. 2001. MIF regulates innate immune responses through modulation of Toll-like receptor 4. Nature 414:920.[Medline]
  27. Perianayagam, M. C., V. S. Balakrishnan, A. J. King, B. J. Pereira, B. L. Jaber. 2002. C5a delays apoptosis of human neutrophils by a phosphatidylinositol 3-kinase-signaling pathway. Kidney Int. 61:456.[Medline]
  28. Hannigan, M., L. Zhan, Z. Li, Y. Ai, D. Wu, C. K. Huang. 2002. Neutrophils lacking phosphoinositide 3-kinase {gamma} show loss of directionality during N-formyl-Met-Leu-Phe-induced chemotaxis. Proc. Natl. Acad. Sci. USA 99:3603.[Abstract/Free Full Text]
  29. Hirsch, E., V. L. Katanaev, C. Garlanda, O. Azzolino, L. Pirola, L. Silengo, S. Sozzani, A. Mantovani, F. Altruda, M. P. Wymann. 2000. Central role for G protein-coupled phosphoinositide 3-kinase {gamma} in inflammation. Science 287:1049.[Abstract/Free Full Text]



This article has been cited by other articles:


Home page
Am. J. Pathol.Home page
F. A. Amaral, C. T. Fagundes, R. Guabiraba, A. T. Vieira, A. L.S. Souza, R. C. Russo, M. P.B. Soares, M. M. Teixeira, and D. G. Souza
The Role of Macrophage Migration Inhibitory Factor in the Cascade of Events Leading to Reperfusion-Induced Inflammatory Injury and Lethality
Am. J. Pathol., December 1, 2007; 171(6): 1887 - 1893.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
L. M. Hoesel, A. D. Niederbichler, J. Schaefer, K. R. Ipaktchi, H. Gao, D. Rittirsch, M. J. Pianko, P. M. Vogt, J. V. Sarma, G. L. Su, et al.
C5a-Blockade Improves Burn-Induced Cardiac Dysfunction
J. Immunol., June 15, 2007; 178(12): 7902 - 7910.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
C. D. Wrann, N. A. Tabriz, T. Barkhausen, A. Klos, M. van Griensven, H. C. Pape, D. O. Kendoff, R. Guo, P. A. Ward, C. Krettek, et al.
The Phosphatidylinositol 3-Kinase Signaling Pathway Exerts Protective Effects during Sepsis by Controlling C5a-Mediated Activation of Innate Immune Functions
J. Immunol., May 1, 2007; 178(9): 5940 - 5948.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
R.-F. Guo, L. Sun, H. Gao, K. X. Shi, D. Rittirsch, V. J. Sarma, F. S. Zetoune, and P. A. Ward
In vivo regulation of neutrophil apoptosis by C5a during sepsis
J. Leukoc. Biol., December 1, 2006; 80(6): 1575 - 1583.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
A. Daryadel, R. F. Grifone, H.-U. Simon, and S. Yousefi
Apoptotic Neutrophils Release Macrophage Migration Inhibitory Factor upon Stimulation with Tumor Necrosis Factor-{alpha}
J. Biol. Chem., September 15, 2006; 281(37): 27653 - 27661.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
H. Suttmann, J. Riemensberger, G. Bentien, D. Schmaltz, M. Stockle, D. Jocham, A. Bohle, and S. Brandau
Neutrophil Granulocytes Are Required for Effective Bacillus Calmette-Guerin Immunotherapy of Bladder Cancer and Orchestrate Local Immune Responses
Cancer Res., August 15, 2006; 66(16): 8250 - 8257.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
R. Kats, M. Al-Akoum, S. Guay, C. Metz, and A. Akoum
Cycle-dependent expression of macrophage migration inhibitory factor in the human endometrium
Hum. Reprod., December 1, 2005; 20(12): 3518 - 3525.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Riedemann, N. C.
Right arrow Articles by Ward, P. A.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Riedemann, N. C.
Right arrow Articles by Ward, P. A.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS