|
|
||||||||
,
,
,
* Department of Pathology,
The Center for Blood Research, and
Department of Cell Biology, Harvard Medical School, Boston, MA 02115; and
Faculty of Science, Charles University, Prague, Czech Republic
| Abstract |
|---|
|
|
|---|
| Introduction |
|---|
|
|
|---|
Using gene-targeted mice that express an I-Ab-green fluorescent protein (GFP) fusion protein in place of I-Ab molecules, we have visualized the transport of class II molecules in live bone marrow-derived DCs (3). In immature/intermediate DCs, class II MHC GFP molecules are found predominantly in internal vesicles and in short tubular compartments (
4 µm in length) which mediate constitutive delivery of class II molecules to the cell surface. Using a retroviral approach to express class II-GFP molecules, Chow et al. (4) showed that upon exposure of DCs to 0.1 µg/ml LPS, these short tubules fuse with the plasma membrane and deliver class II molecules to the cell surface. We examined the rearrangement of class II MHC trafficking in Ag-loaded DCs confronted with Ag-specific T cells. Only when Ag-specific T cells were added to Ag-loaded DCs did we observe the rearrangement of endosomal class II-positive compartments into much longer tubular structures (average,
20 µm in length) (3). In the current study, we focus on the priming signals in DCs to generate endosomal tubulation rather than the role of such endosomal tubules to deliver class II molecules to the cell surface. In our analyses, we quantitated numerous DC/T cell conjugates after engagement of Ag-specific T cells by analysis of still images rather than movies.
Although we used highly purified preparations of hen egg lysozyme and OVA as Ags for these initial experiments (3), the presence of low concentrations of contaminating endotoxin is likely. Even these low levels of endotoxin may deliver a signal to the DC that would then allow them to respond by tubulation toward the T cell with which it interacts. To study the effect of LPS on endosomal tubulation upon Ag-specific T cell contact, three approaches were taken. First, we extracted egg white from the sterile interior of chicken eggs as a source of LPS-free Ag. We show that LPS-free egg white fails to evoke tubulation and that addition of low concentrations of LPS restores the ability of this crude Ag preparation to induce tubule formation, but without massive translocation of class II MHC molecules to the cell surface.
Second, we generated I-Ab-GFP mice deficient in the myeloid differentiation factor 88 (MyD88), an adaptor molecule recruited to the cytoplasmic tail of Toll-like receptors (TLR) 26 and 9 as well as IL-1 and IL-18 receptors upon their ligation (5, 6, 7, 8, 9). In the absence of MyD88, cells are defective in their response to LPS and CpG and, as we show here, fail to respond to Ag-specific T cells by tubulation.
Third, MyD88 may have roles in DC development as well as in their TLR-mediated activation, but to distinguish these two aspects is not always straightforward. TNFR-associated factor 6 (TRAF6) transmits signals from activated TLR and is positioned downstream of MyD88 but TRAF6 has no apparent role in DC development (10, 11). When we treated wild-type (WT)-I-Ab-GFP DCs with a cell permeable peptide that inhibits TRAF6 signaling (12), endosomal tubulation was impaired. Together, our data show a requirement for a microbial signal as a prerequisite for DCs to show polarized tubulation of endosomal membranes toward an interacting naive CD4 T cell.
| Materials and Methods |
|---|
|
|
|---|
I-Ab-GFP knockin mice have been described previously (3). MyD88-/- mice were kindly provided by S. Akira (8). I-Ab-GFP mice were crossed with MyD88-/- mice to generate I-Ab-GFP-expressing mice deficient in MyD88. Genotyping for the MyD88 mutation was performed as described elsewhere (8). Mice were housed in a barrier facility and studies were performed according to institutional guidelines for animal use and care.
Pulse-chase analysis and immunoprecipitations
Pulse-chase experiments and immunoprecipitations were performed as described previously (3, 13). Briefly, bone marrow cultures were pulsed for 45 min with 0.5 µCi/ml [35S]methionine/cysteine (New England Nuclear) and chased in complete DMEM for 3 h. After each chase point, cells were lysed in Nonidet P-40 lysis buffer (pH 7.4) supplemented with 1% SDS. Class II molecules were recovered by immunoprecipitation with the N22 Ab, a reagent that captures properly folded and assembled class II molecules (N22 was a gift from R. M. Steinman, Rockefeller University, New York, NY). Immunoprecipitates were recovered using Formalin- fixed staphylococcal A, washed four times with washing buffer (0.5% Nonidet P-40, 50 mM Tris-HCl (pH 7.4), 150 mM NaCl, and 5 mM EDTA), resuspended in sample buffer containing 5% 2-ME, either boiled or kept on ice for 5 min, and analyzed by SDS-PAGE.
Flow cytometry
DCs were characterized by expression of CD11c, with a PE-conjugated mAb to CD11c. Location of class II molecules was measured by analysis of the ratio of surface-exposed class II with a PE-conjugated mAb specific for I-Ab vs I-Ab-GFP, which visualizes all class II molecules irrespective of their location. Activation of DCs was measured with PE-conjugated mAb to the costimulatory molecule CD86. All fluorochrome-conjugated Abs were obtained from BD Biosciences (Mountain View, CA).
Cell preparation and culture
DCs were generated as described previously (3, 13). In short, cells were flushed from the bone marrow cavity with PBS/2.5% FCS. Cells were plated at 1 x 106 cells/well in 2 ml of DMEM/25 mM HEPES/10% FCS without phenol red and 10 ng/ml GM-CSF (PeproTech, Rocky Hill, NJ) and 1 ng/ml IL-4 (Roche Molecular Biochemicals, Somerville, NJ). Cells were cultured on 25-mm circular coverslips, with changes of media every second day; nonadherent cells were removed by gentle washing on days 2 and 4.
Real-time imaging of MHC class II-GFP in bone marrow DCs
Day 5 bone marrow DCs were used for imaging. For discrimination of early and late endocytic compartments, DCs were incubated with 25 µg/ml transferrin (Tf) Alexa Fluor 594 (early endosomes; Molecular Probes, Eugene, OR) or 25 µg/ml lysotracker Alexa Fluor 594 (late endosomes; Molecular Probes) for 30 min at 37°C in DMEM without serum and washed three times. Images were captured with an inverted Zeiss 200M microscope equipped with a x63 objective (1.4NA PlanApo) and a spinning wheel confocal head (PerkinElmer, Wellesley, MA). Cells were kept in a 37°C open perfusion temperature-controlled chamber (20/20 Technology, Wilmington, NC). Slidebook (Intelligent Imaging Innovation, Denver, CO) was used for image acquisition and data processing.
Ag presentation in real time
DCs seeded at a concentration of 1 x 106/coverslip were incubated with 20 µM OVA (Roche Molecular Biochemicals) or the equivalent amount of OVA in the form of crude egg white (extracted from fresh eggs; crude egg white consists for 54% of OVA (14)) for 4 h to induce display of Ag-derived peptides on class II molecules. DCs were then washed three times with media. Freshly isolated OVA-specific OTII T cells were obtained from lymph nodes from OTII-transgenic mice. T cells (1 x 106) were labeled with the nuclear dye Hoechst 33258 (Molecular Probes), washed, and added to each coverslip containing DCs. T cells were brought into contact with DCs by a 1-min centrifugation step at 1200 rpm at room temperature. Confocal microscopy analysis was done within 1 and 2 h after T cell addition. Images were collected in a double-blind fashion and analyzed for tubulation on a separate occasion by two individuals.
Peptides
A TRAF6-binding peptide fused with the hydrophobic sequence (AAVALLPAVLLALLAP) from Kaposi fibroblast growth factor signal sequence (L-T6DP-1) was prepared as described elsewhere (12). The TRAF6-binding decoy peptide, AAVALLPAVLLALLAP-RKIPTEDEYTDRPSQPST, and a control peptide that has its TRAF6-binding sequence scrambled: AAVALLPAVLLALLAP-RKIEYPETDTDRPSQPST (signal sequence in italics and the TRAF6-binding motif and its scrambled version are underlined) were synthesized on an Advanced ChemTech 40 channel peptide synthesizer using standard F-moc chemistry. The molecular mass of each peptide was confirmed by matrix-assisted laser desorption ionization time-of-flight mass spectrometry. DCs at a concentration of 1 x 106/coverslip were pretreated with decoy TRAF6 peptide or with control peptide (20 µM, 1 h, 37°C) before following the "Ag presentation in real-time" protocol above.
Statistical analysis
An unpaired two-tailed t test was used for statistical analysis. Values of p below 0.05 are considered significant and are given in the figure legends.
| Results |
|---|
|
|
|---|
To explore the notion that DCs may need an adjuvant-like signal to allow T cell-dependent tubulation (2, 15), we prepared OVA devoid of LPS or other microbial signatures in the following manner. We extracted egg white directly from the sterile interior of fresh chicken eggs. Egg white consists of 54% (w/v) OVA (14), and this crude preparation, appropriately diluted, was used as Ag. Hereafter, crystalline OVA will be referred to as OVA and egg white extracts will be referred to as crude egg white. In contrast to commercial preparations of crystalline OVA, inclusion of crude egg white failed to activate DCs, as judged by a lack of increase in surface expression of class II MHC and CD86 after overnight culture (20 µM normalized OVA; Fig. 1). We estimate that the batch of crystalline OVA we used contains
1 ng/ml LPS. By comparing T cell stimulation obtained with OVA and crude egg white to which increasing concentrations of LPS had been added, we obtained equivalent up-regulation of CD69 on naive OTII cells (TCR transgenic, I-Ab restricted, OVA specific) at 1 ng/ml added LPS in crude egg white as compared with OVA (data not shown).
|
-chain with GFP. Such animals are phenotypically normal with respect to their immune system. We generated DCs by culture of bone marrow cells with GM-CSF and IL-4 (3). DCs are generally cultured in plastic tissue culture dishes, but for confocal microscopy, cells must be examined on glass coverslips. We compared DCs cultured on glass coverslips with DCs maintained in plastic tissue culture dishes by staining for CD11c and CD86 and detected no significant differences in numbers or marker profiles of CD11c/class II double-positive cells. At day 5 of culture, approximately one-third of the cells expressed class II GFP, of which 8090% expressed the DC marker CD11c and were therefore considered DCs. The majority of DCs, whether grown on plastic or glass, exhibited low levels of CD86 (data not shown). In bone-marrow-derived DCs generated from I-Ab-GFP mice and loaded with the appropriate Ag, we observed a dramatic rearrangement of endosomal compartments in response to T cells specific for that Ag (3). Tubules were classified according to their direction toward the T cell in each DC/T cell conjugate; those tubules that extend directly toward the interacting T cell are classified as "1," tubules with a vector in the direction of, but not directly pointing at the T cell are classified as "2," and tubules pointing away from the interacting T cell are classified as "3" (3). An example of a DC/T cell conjugate devoid of tubules, hence scored negative for categories 1, 2, and 3, is shown in Fig. 2A.
|
|
To examine the role of MyD88 in the activation of DCs, we compared the behavior of class II molecules in DCs from WT and MyD88-/- mice. We crossed the I-Ab-GFP knockin mutation onto the MyD88-/- background and generated DCs by culture of bone marrow in the presence of IL-4 and GM-CSF from WT class II-GFP (WT-I-Ab-GFP hereafter) and MyD88-/- I-Ab-GFP (MyD-I-Ab-GFP hereafter) mice (3, 13). For both WT and MyD88-deficient cultures, many clusters of I-Ab-GFP-positive cells were present at day 5 of culture, 90% of which expressed the DC marker CD11c (Fig. 3A). As assessed by both surface staining and GFP levels, we observe a moderately reduced expression of I-Ab in a subpopulation of CD11c-positive cells from the MyD-I-Ab-GFP DCs (Fig. 3B). Thus, the generation of DCs from bone marrow precursors in vitro is mostly normal in MyD-I-Ab-GFP cells.
|
In professional APCs, at steady state, class II MHC molecules reside predominantly in endosomal compartments. Bone marrow-derived DCs were allowed to endocytose Alexa-labeled Tf, which localizes to early and recycling endosomes, and were then examined by confocal microscopy. In both WT-I-Ab-GFP and MyD-I-Ab-GFP DCs, little or no colocalization of class II-GFP and Tf-Alexa is seen (data not shown), consistent with the known distributions of class II MHC and the Tf receptor (3, 17, 18, 19, 20). To determine the location of class II MHC molecules in the endosomal pathway of WT-I-Ab-GFP and MyD-I-Ab-GFP DCs, cells were allowed to endocytose Alexa-lysotracker (data not shown). In GFP-positive cells, all lysotracker-labeled compartments were also class II-GFP positive, with only small quantities of class II-GFP outside of endosomal compartments. We conclude that the localization of class II MHC molecules in the MyD88-/- cells is indistinguishable from that in WT.
Normal peptide loading on class II molecules in MyD88-deficient DCs
Normal levels of surface expression of class II molecules at steady state do not necessarily imply that peptide loading of class II molecules occurs normally in APCs (21, 22). To exclude aberrations in biosynthesis and peptide loading of class II molecules in MyD88-/- APCs, we analyzed the rate of intracellular transport and peptide acquisition by pulse-chase analysis and examination of the SDS resistance of class II MHC molecules. Freshly isolated spleen cells and cultured bone marrow-derived DCs were obtained from WT and MyD88-/- mice. We then examined maturation and peptide acquisition of newly synthesized class II complexes (Fig. 3, C and D) as judged by the presence of SDS-stable dimers. Low levels of stable dimer formation were seen in freshly extracted bone marrow and after day 3 of culture, the levels of stable class II MHC dimers increased (data not shown). At no time did we observe differences in stable dimer formation between WT and MyD88-/- APCs. Thus, the absence of MyD88 does not affect class II biosynthesis and peptide acquisition, as assessed by this method.
Abnormal rearrangement of endosomes upon T cell engagement of MyD-I-Ab-GFP DCs
Is MyD88 required in DCs to generate tubular endosomes that polarize toward an interacting T cell? We studied the fate of class II-containing compartments in DCs upon contact with naive CD4 T cells as described previously (3). First, we determined the uptake of fluorescein-conjugated OVA by WT and MyD88-/- DCs as a measure of their endocytic capacity (Fig. 4). We obtained similar numbers of CD11c+ cells from WT and MyD88-/- bone marrow cultures (Fig. 4, top panels) and found that their ability to endocytose OVA was indistinguishable (Fig. 4, bottom panels). Thus, the MyD88 deficiency does not affect endocytosis of soluble OVA in bone marrow-derived DCs.
|
For WT-I-Ab-GFP DCs, tubulation was readily apparent upon contact with Ag-specific T cells. In the presented image, tubulation was bipolar, directed toward both interacting T cells (Fig. 5A, left). In contrast, in the MyD-I-Ab-GFP DC/T cell conjugates, no such tubulation of class II-positive compartments occurred (Fig. 5A, right). Of 57 MyD88-/- DC/T cell conjugates analyzed, the overall average length of tubules was 4 µm, whereas in the WT DCs, the average length of category 1, 2 and 3 tubules was 22.2, 15.8, and 6.6 µm, respectively (Fig. 5B and Table II). The few tubulations observed in MyD88-/- DCs were of no preferred orientation and were of much reduced length, perhaps similar to the tubules observed in DCs in the absence of Ag (3, 4, 16). A quantitation of the tubule length, orientation, and frequency is given in Table II. Thus, DCs require MyD88 for rapid induction of tubular class II-positive compartments induced by Ag-specific T cell ligation.
|
|
Ligation of TLR with microbial products results in recruitment of MyD88 to the cytoplasmic region of a TLR. The bound MyD88 then recruits IL-1R-associated kinase to the receptor, which upon activation is released from the receptor complex and binds and activates TRAF6 for stimulation of the I
B kinase complex, mitogen-activated protein kinase (9), and possibly other kinases as well. The phenotype of TRAF6-deficient mice shows that TRAF6 is essential for cellular responses to LPS and IL-1 (10, 23). Cell-permeable peptides that can form a complex with TRAF6 have been used successfully as decoys to inhibit TRAF6 signaling (12).
Can DCs in which TRAF6 signaling is inhibited still induce tubulation of class II MHC compartments? We synthesized a cell-permeable TRAF6 decoy and a scrambled control peptide (Fig. 6A; Ref.12) and pretreated WT-I-Ab-GFP DCs with peptide (20 µM, 1 h at 37°C) before addition of crystalline OVA. DCs were allowed to endocytose OVA for 4 h and then washed and exposed to naive OTII T cells. In WT-I-Ab-GFP cells treated with a peptide in which the TRAF6-binding sequence is scrambled, contacts between T cells and DCs result in pronounced tubulation of class II-positive compartments toward the T cell. In DC/T cell conjugates treated with the TRAF6 decoy peptide, no such tubulation of class II-positive compartments occurred (Fig. 6B). On average, the tubule length for TRAF6 decoy-treated DCs was 4.9 µm, whereas in the experiment shown for the control peptide-treated DCs, the average lengths of category 1, 2, and 3 tubules were 13.7, 8.6, and 4.1 µm, respectively (Fig. 6B and Table III). Thus, DCs require a priming event through TLR ligation to induce class II-positive tubular endosomes upon interaction with Ag-specific T cells, yet such activation does not entail massive translocation of class II MHC molecules to the cell surface.
|
|
| Discussion |
|---|
|
|
|---|
Using bone marrow-derived DCs from I-Ab-GFP knockin animals, we showed that Ag-loaded DCs interact with Ag-specific naive T cells and rearrange their class II-positive endosomal compartments into tubular structures of considerable length. This tubulation was seen in the absence of added LPS and was strictly Ag dependent. Still, LPS contamination of commercial Ags is a well-known occurrence and raises the question whether this mode of tubulation is dependent only on an Ag-specific encounter with an appropriate T cell, or whether an additional factor (e.g., a TLR-delivered signal) is required that may prime DCs for this behavior.
As a source of LPS-free Ag, we used crude egg white extracted directly from a chicken egg and compared it with OVA obtained commercially. Treatment with OVA resulted in prominent tubulation upon interaction with Ag-specific T cells, but treatment with crude egg white did not. Addition of LPS (1 ng/ml) to crude egg white restored tubulation to the same extent as that observed when treated with commercial OVA. Of note, at this concentration of added LPS, no massive translocation of class II molecules to the cell surface occurs.
The presence of LPS is detected by DCs through ligation of TLR4, which uses the adapter molecule MyD88 and TRAF6 for signal transduction to the nucleus (24). MyD88-/- DCs consistently failed to respond to an Ag-specific encounter by tubulation, even though synthesis and maturation of class II MHC molecules occur normally, and surface expression of class II MHC molecules in immature DCs is affected only very slightly, if at all. A 1-h treatment of WT-I-Ab-GFP DCs with cell-permeable inhibitory peptide to TRAF6 also prevented Ag-specific T cell ligation-induced tubulation. These results are fully consistent with those shown for the comparison between endotoxin-free Ag and the commercially available Ag preparation. We may thus consider tubulation a sign of activation of DCs, a state apparently distinct from that provoked by exposure to a high concentration of LPS in the absence of T cells or Ag.
All experiments described here involve TLR signaling as a prerequisite for the development of tubular endosomes and were analyzed for DC/T cell conjugates. Tubular class II-positive endosomes depend on the correct combination of Ag and T cell specificity (3). The majority of these tubules are T cell directed, but we observe the occurrence of occasional T cell-independent tubulation as well. Indeed, T cell-independent tubulation of endosomal compartments was described before, after treatment of the DCs at concentrations of LPS of 100 ng/ml or higher (4, 16). The tubular endosomes observed were
5 µm in length or less (4, 16). Under our experimental conditions, we established the involvement of contaminating amounts of LPS (in the order of 1 ng/ml) present in the Ag in the formation of T cell-polarized endosomal tubulation. Tubular endosomes described here may originate from the same source as the LPS-induced tubules. Their polarization toward Ag-specific T cells and their length indicates a role in the transport of peptide-loaded class II MHC molecules to the site of T cell contact.
Signaling events initiated by TLR ligation involve initiation of transcription of genes that encode costimulatory products such as CD86, CD80, and CD40 and of inflammatory cytokine genes such as TNF-
and IFN-
(25). MyD88-/- cells are unable to produce IL-12 and TNF-
upon ligation of TLR 2, 4, and 9 (25, 26, 27). Bone marrow-derived MyD88-/-DCs are defective in class II MHC-restricted presentation, as demonstrated by their reduced ability to activate naive CD4 T cells after exposure to heat-killed and dried Mycobacterium tuberculosis (24). In vitro, MyD88 is dispensable in activation of Ag-specific or allogeneic T cells by DCs in 3-day coculture experiments (28), which at first sight appears at variance with our data, that show a MyD88 requirement for the formation of tubular endosomes. After 3 days of coculture of DCs with T cells in vitro, sufficient quantities of peptide-loaded class II MHC will likely have reached the cell surface and the MyD88 requirement may no longer be critical.
LPS activates DCs in vitro via TLR4 in a manner that is mostly dependent on MyD88-/-, yet can be bypassed (26, 28, 29). This bypass requires high doses of LPS (between 0.1 and 1 µg/ml) (4, 13), far more than the LPS concentration necessary and sufficient for tubulation. Concentrations of LPS in the 0.11 µg/ml range are used to generate mature DCs from less mature precursors, a process accompanied by massive translocation of class II MHC molecules to the cell surface (4, 13). Whether such concentrations resemble those encountered in the course of an infection in vivo is not known.
Based on the results presented here, we should like to propose a two-signal model for DC activation that may not require massive translocation of class II MHC molecules to the surface of DCs. The priming of DCs occurs when low amounts of microbial signatures are present, which may be in the physiological range during the pathogenic insult. Such priming may also be sufficient to render DCs responsive to appropriate chemokine gradients and allow them to migrate to draining lymph nodes (30). After priming, the DC retains the majority of its loaded class II MHC molecules sequestered in endosomes. Only little class II MHC needs to be delivered to the cell surface to allow the initial engagement of an Ag-specific T cell. Upon arrival of DCs in a draining lymph node, rapid transport of further class II MHC molecules to the plasma membrane may occur via sustained tubulation. DCs require a microbial priming signal to IL-12 p70 production after ligation of cell surface CD40 (31). Immature DCs express very little CD40, but display CD40 within hours of microbial stimulation. Moreover, naive Ag-specific T cells express CD40 ligand only following TCR stimulation (32). In the experiments described here, we used naive T cells and therefore the extended endosomes are unlikely to be the consequence of a CD40-CD40 ligand-mediated signaling cascade.
Having encountered an Ag-specific T cell, tubulation may be beneficial for the contacting Ag-specific T cell to experience serial triggering of its T cell receptors (33, 34, 35, 36). Activation of a naive T cell requires prolonged interaction with an APC and presumably sustained delivery of class II molecules to the site of contact between DCs and T cells. Nonetheless, we have yet to demonstrate that class II MHC molecules contained in these long tubules are in fact delivered to the cell surface. The technical limitations of total internal reflection fluorescence microscopy restrict a direct observation of fusion events to those that occur at the interface of the cell and the coverslip on which it is grown. This limitation notwithstanding, a state of DC activation may be defined that requires the two types of signal discussed above: a microbial signature and a T cell-dependent event. Imaging of DCs in lymph node in situ, with circulation and lymphatic drainage intact, will be required to establish whether the behavior of DCs, as seen here in vitro, applies equally to DCs in vivo.
| Acknowledgments |
|---|
| Footnotes |
|---|
2 Address correspondence and reprint requests to Dr. Hidde Ploegh, Department of Pathology, Harvard Medical School, 200 Longwood Avenue, Boston, MA 02115. E-mail address: ploegh{at}hms.harvard.edu ![]()
3 Abbreviations used in this paper: DC, dendritic cell; GFP, green fluorescent; TLR, Toll-like receptor; Myd88, myeloid differentiation factor 88; TRAF6, TNFR-associated factor 6; WT, wild type; Tf, transferrin. ![]()
Received for publication May 12, 2003. Accepted for publication July 28, 2003.
| References |
|---|
|
|
|---|
This article has been cited by other articles:
![]() |
I. Tirapu, B. Giquel, L. Alexopoulou, S. Uematsu, R. Flavell, S. Akira, and S. S. Diebold PolyI:C-induced reduction in uptake of soluble antigen is independent of dendritic cell activation Int. Immunol., July 1, 2009; 21(7): 871 - 879. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. A. West, A. R. Prescott, K. M. Chan, Z. Zhou, S. Rose-John, J. Scheller, and C. Watts TLR ligand-induced podosome disassembly in dendritic cells is ADAM17 dependent J. Cell Biol., September 8, 2008; 182(5): 993 - 1005. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Majewski, T. O. Bose, F. C. M. Sille, A. M. Pollington, E. Fiebiger, and M. Boes Protein kinase C delta stimulates antigen presentation by Class II MHC in murine dendritic cells Int. Immunol., June 1, 2007; 19(6): 719 - 732. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. M. Vyas, Y.-M. Kim, K. Artavanis-Tsakonas, J. C. Love, A. G. Van der Veen, and H. L. Ploegh Tubulation of Class II MHC Compartments Is Microtubule Dependent and Involves Multiple Endolysosomal Membrane Proteins in Primary Dendritic Cells J. Immunol., June 1, 2007; 178(11): 7199 - 7210. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. Pichlmair, S. S. Diebold, S. Gschmeissner, Y. Takeuchi, Y. Ikeda, M. K. Collins, and C. Reis e Sousa Tubulovesicular Structures within Vesicular Stomatitis Virus G Protein-Pseudotyped Lentiviral Vector Preparations Carry DNA and Stimulate Antiviral Responses via Toll-Like Receptor 9 J. Virol., January 15, 2007; 81(2): 539 - 547. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. Sun, M. Walsh, A. V. Villarino, L. Cervi, C. A. Hunter, Y. Choi, and E. J. Pearce TLR Ligands Can Activate Dendritic Cells to Provide a MyD88-Dependent Negative Signal for Th2 Cell Development J. Immunol., January 15, 2005; 174(2): 742 - 751. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. A. West, R. P. A. Wallin, S. P. Matthews, H. G. Svensson, R. Zaru, H.-G. Ljunggren, A. R. Prescott, and C. Watts Enhanced Dendritic Cell Antigen Capture via Toll-Like Receptor-Induced Actin Remodeling Science, August 20, 2004; 305(5687): 1153 - 1157. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Palliser, H. Ploegh, and M. Boes Myeloid Differentiation Factor 88 Is Required for Cross-Priming In Vivo J. Immunol., March 15, 2004; 172(6): 3415 - 3421. [Abstract] [Full Text] [PDF] |
||||
![]() |
N. S. Wilson, D. El-Sukkari, and J. A. Villadangos Dendritic cells constitutively present self antigens in their immature state in vivo and regulate antigen presentation by controlling the rates of MHC class II synthesis and endocytosis Blood, March 15, 2004; 103(6): 2187 - 2195. [Abstract] [Full Text] [PDF] |
||||
![]() |
N. Bertho, J. Cerny, Y.-M. Kim, E. Fiebiger, H. Ploegh, and M. Boes Requirements for T Cell-Polarized Tubulation of Class II+ Compartments in Dendritic Cells J. Immunol., December 1, 2003; 171(11): 5689 - 5696. [Abstract] [Full Text] [PDF] |
||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |