|
|
||||||||



Departments of
*
Pulmonology, and
Immunohematology and Bloodtransfusion, Leiden University Medical Center, Leiden, The Netherlands; and
The Granulocyte Research Laboratory, Department of Hematology, Copenhagen University Hospital, Copenhagen, Denmark
| Abstract |
|---|
|
|
|---|
| Introduction |
|---|
|
|
|---|
Human CAP-18, the only human cathelicidin identified to date, was first identified in neutrophils (1) and later shown to be expressed in various squamous epithelia (2), surface epithelial cells of the conducting airways, and serous and mucous cells of the submucosal glands (3), by keratinocytes in inflamed skin (4) and by specific lymphocyte and monocyte populations (5). It belongs to the cathelicidin family of antimicrobial peptides that are characterized by a conserved N-terminal cathelin domain and a variable C-terminal antimicrobial domain. This C-terminal domain can be cleaved off from the precursor by proteinases, releasing the active peptide. Exocytosed material from neutrophils contains hCAP-18 that has been proteolytically cleaved by proteinase-3 yielding the
4.5 kD active
helical peptide LL-37 (6). LL-37 displays antimicrobial activity against a broad spectrum of microorganisms (7) and neutralizes LPS bioactivity (8, 9). The importance of cathelicidins for an effective host defense against infection is illustrated by a recent study showing that mice deficient in the murine cathelicidin-related antimicrobial peptide suffer from more severe bacterial skin infections (10). Overexpression of LL-37/hCAP-18 after pulmonary gene transfer in mice was shown to inhibit bacterial load and inflammatory response following pulmonary Pseudomonas aeruginosa challenge, whereas systemic gene transfer was shown to protect against endotoxemia (11). Also other activities were described for LL-37, including chemotactic activity toward neutrophils, monocytes, and T cells through binding to the G protein-coupled fMLP receptor, the formyl peptide receptor-like (FPRL) 1 (12), chemotactic activity toward mast cells (13), and stimulation of mast cell degranulation (14). Furthermore, a recent study by Scott et al. (15) showed that LL-37 activates lung epithelial cells and macrophages. Although a selective deficiency of CAP-18/LL-37 in humans has not been described, a recent study shows that the neutrophils from patients with morbus Kostmann, a severe congenital neutropenia, are deficient in CAP-18/LL-37 (16). This deficiency is accompanied by the occurrence of infections and periodontal disease, suggesting that CAP-18/LL-37 is involved in antimicrobial defense in humans.
Neutrophil-derived products, including antimicrobial peptides and serine proteinases, have been shown to activate airway epithelial cells (17, 18, 19). Neutrophil defensins are small cationic antimicrobial and chemotactic peptides (20) that activate host cells in vitro (17, 21) and cause lung injury in vivo (22). Neutrophil defensins induce IL-8 release from airway epithelial cells (17) and have been shown to increase airway epithelial cell proliferation, a process which is dependent on activation of the mitogen-activated protein kinases (MAPKs) extracellular signal-regulated kinase (ERK)1/2 (21). This suggests that these peptides may regulate cellular activity in the airway epithelium.
The aim of the present study was to investigate whether LL-37 activates airway epithelial cells. To this end ERK1/2 activation and IL-8 release in airway epithelial cells were determined. Given the key role of the epidermal growth factor receptor (EGFR) in growth factor-mediated ERK1/2 activation, we explored the involvement of EGFR in this process. Our results indicate that LL-37, in addition to its antimicrobial and chemotactic activities, may also contribute to innate immunity by activation of airway epithelial cells.
| Materials and Methods |
|---|
|
|
|---|
LL-37 (amino acid sequence [LL-37, 37 aa]) was synthesized by solid phase peptide synthesis on a TentagelS-AC (Rapp, Tübingen, Germany) using 9-fluorenylmethoxycarbonyl/t-Bu chemistry, benzotriazole-1-yl-oxy-tris-pyrrolidino-phosphonium hexafluorophosphate/N-methylmorpholine for activation and 20% piperidine in N-methylpyrrolidone for fluorenylmethoxycarbonyl removal. The peptide was cleaved from the resin and deprotected with trifluoroacetic acid/water and purified on Vydac C18. The purified peptide was analyzed by RP-HPLC and the molecular mass was confirmed by MALDI-TOF mass spectrometry.
Human CAP-18 was isolated from neutrophils (6). Rabbit polyclonal anti-phosphorylated ERK1/2, p38 and c-Jun N-terminal kinase (JNK) Abs, and total ERK1/2, p38 and JNK Abs, were purchased from New England Biolabs (Beverly, MA). The inhibitors AG1478 (Calbiochem, La Jolla, CA), PD98059 (Alexis, Nottingham, U.K.), U0126 (Promega, Madison, WI), LY294002 (Stratagene, La Jolla, CA), and GM6001 (Chemicon International, Temecula, CA) were used to study pathways involved in activation of airway epithelial cells. Neutralizing Abs against amphiregulin, heparin-binding (HB)-EGF, and TGF-
were purchased from R&D Systems (Minneapolis, MN), and neutralizing anti-EGFR Abs from Lab Vision (Fremont, CA). Apocynin was obtained from Janssen (Beerschot, Belgium) and N-acetylcysteine (NAC), pertussis toxin, and TGF-
were obtained from Sigma-Aldrich (St. Louis, MO).
Generation of anti-LL-37 mAbs
Anti-LL-37 mAbs were generated using conventional hybridoma technology, and generation of these Abs has been described in part (6). Briefly, female BALB/c mice were s.c. immunized with a mixture of synthetic native and glutaraldehyde cross-linked LL-37 in Freunds complete adjuvant, and received a booster injection with LL-37 in Freunds incomplete adjuvant. Four days after an intrasplenal injection with LL-37, spleen cells were isolated and fused with cells from the SP2/0 mouse myeloma cell line. Hybridomas producing LL-37 specific IgG Abs were identified by ELISA and subcloned by limiting dilution. Reactivity and specificity were analyzed by dot blot analysis using LL-37 and by immunohistochemistry on formalin-fixed bronchial tissue. Abs were purified from culture supernatant by protein G affinity chromatography using the ÄKTAprime System (Amersham Pharmacia Biotech, Uppsala, Sweden).
Cell cultures
Cells from the mucoepidermoid lung carcinoma cell line NCI-H292 were obtained from the American Type Culture Collection (Manassas, VA) and cultured in RPMI 1640 medium (Life Technologies, Grand Island, NY) supplemented with 2 mM L-glutamine, 20 U/ml penicillin, 20 µg/ml streptomycin (all from BioWhittaker, Walkersville, MD) and 10% heat-inactivated FCS (Life Technologies) at 37°C and 5% CO2. Cells were passaged weekly using 0.25% (w/v) trypsin and 0.1% (w/v) EDTA.
Primary bronchial epithelial cells (PBEC) were isolated from macroscopically normal bronchial tissue that was obtained from patients who underwent lung surgery for lung cancer at the Leiden University Medical Center (Leiden, The Netherlands). PBEC were obtained from bronchial rings using enzymatic digestion of tissue as previously described (23). Cells were cultured in 6-well plates that were precoated with a combination of Vitrogen (30 µg/ml; Celtrix Laboratories, Palo Alto, CA), fibronectin (10 µg/ml; isolated from human plasma), and BSA (10 µg/ml; Boehringer Mannheim, Mannheim, Germany), in keratinocyte serum-free medium (Life Technologies), supplemented with EGF (0.2 ng/ml; Life Technologies), bovine pituitary extract (25 µg/ml; Life Technologies), isoproterenol (1 µM; Sigma-Aldrich), 20 U/ml penicillin, 20 µg/ml streptomycin at 37°C and 5% CO2. Cyproxin (10 µg/ml; Bayer, Wuppertal, Germany) was included in the culture medium during the first week of culture. After trypsinizing (0.03% (w/v) trypsin, 0.01% (w/v) EDTA, 0.1% (w/v) glucose in PBS, pH 7.5), cells were stored in liquid nitrogen or subcultured.
Stimulation of NCI-H292 cells and subcultures of PBEC
NCI-H292 cells were cultured in tissue culture plates and after reaching near-confluence, the cells were rinsed with PBS and starved overnight in serum-free RPMI 1640 medium. The next day, the cells were stimulated in serum-free medium.
PBEC were used at passage 2 and cultured in tissue culture plates in DMEM/Hams F12 (1:1) medium (Life Technologies) supplemented with 10 ng/ml EGF, 2% (v/v) Ultroser G (Life Technologies), 1 µM isoproterenol, 1 µM insulin (Sigma-Aldrich), 1 µM hydrocortisone (Sigma-Aldrich), 2 mM L-glutamine, 1 mM HEPES, 200 U/ml penicillin and 200 µg/ml streptomycin. After reaching near-confluence, cells were starved overnight in DMEM/Hams F12 medium supplemented with 2 mM L-glutamine, 1 mM HEPES, 200 U penicillin and 200 µg/ml streptomycin, and subsequently stimulated in this medium. After stimulation, supernatant was collected, and either RNA was isolated or cellular lysates were prepared.
Cellular lysates
After washing airway epithelial cells in washing buffer (5 mM Tris, 100 mM NaCl, 1 mM CaCl2, 1 mM MgCl2), cells were lysed in ice-cold lysis buffer (0.5% (v/v) Triton X-100, 1 mM Na3VO4 and mini-complete protease inhibitor mixture (Boehringer Mannheim, Basel, Switzerland) in washing buffer) for 15 min on ice. Cells were scraped from the wells and collected. After centrifugation for 5 min at 13,000 rpm at 4°C, the supernatant was collected and stored at -20°C. Protein concentrations of the lysates were measured by the bicinchoninic acid protein assay system (Pierce, Rockford, IL).
Gel electrophoresis and Western blotting
Gel electrophoresis and Western blotting were performed with Bio-Rad (Hercules, CA) systems according to the manufacturers instructions. Samples were subjected to SDS-PAGE on a 10% glycine-based gel, and dissolved proteins were transferred to a polyvinylidene difluoride membrane (ERK1/2), or to nitrocellulose (p38 and JNK). Nonspecific binding sites were blocked, and the blots were incubated with rabbit polyclonal Abs against phosphorylated and total ERK1/2, p38 or JNK, and total ERK1/2, p38 or JNK, and secondary HRP-conjugated anti-rabbit IgG Abs. The ECL Western blotting detection system (Amersham Pharmacia Biotech) was used to reveal immunoreactivity. Densitometry was performed, and the ratio phosphorylated ERK1/2 and total ERK1/2 for each sample was calculated. Data from one experiment are representative of three individual experiments.
IL-8 ELISA
IL-8 levels were measured in cell-free supernatants using IL-8-specific sandwich ELISAs (CLB, Amsterdam, The Netherlands and BioSource International, Nivelles, Belgium).
| Results |
|---|
|
|
|---|
To study the effect of LL-37 on IL-8 release in airway epithelium, cells from the mucoepidermoid lung carcinoma cell line NCI-H292 and subcultures of PBEC were stimulated for different time periods with various concentrations of LL-37, and IL-8 release in cell-free supernatants was determined by IL-8-specific ELISA. LL-37 was shown to induce a concentration- and time-dependent increase in IL-8 release in both NCI-H292 cells (Fig. 1A) and PBEC (Fig. 1B). In contrast to LL-37, equimolar concentrations of the precursor protein hCAP-18 did not increase IL-8 release, indicating that hCAP-18 processing is required for activation of airway epithelial cells (data not shown). Cell viability after stimulation with various concentrations of LL-37 was studied by MTT mitochondrial activity assay (data not shown). At a concentration of 100 µg/ml, LL-37 decreased mitochondrial activity of NCI-H292 cells, whereas concentrations of 33 µg/ml and lower did not affect mitochondrial activity.
|
Because ERK1/2 activation has been shown to be involved in IL-8 release, the effect of LL-37 on ERK1/2 activation in NCI-H292 cells was studied. Cells were stimulated with various concentrations of LL-37, or with TGF-
as a control, and both phosphorylated and total ERK1/2 levels were determined using Western blot analysis. LL-37 was shown to induce a concentration-dependent increase in ERK1/2 activation (Fig. 2A). After 15 min stimulation, ERK1/2 activation was most pronounced (data not shown), and therefore in additional experiments ERK1/2 activation was determined after 15 min stimulation. In contrast to LL-37, the precursor protein hCAP-18 used at equimolar concentrations, did not activate ERK1/2, indicating that only the mature peptide LL-37 activates airway epithelial cells (Fig. 2B). Furthermore, pertussis toxin did not inhibit LL-37-induced ERK1/2 activation, suggesting that G protein-coupled receptors (GPCR) may not be involved in this process (Fig. 2C). To study the specificity of LL-37-induced ERK1/2 activation, LL-37 was preincubated for 2 h with a monoclonal anti-LL-37 Ab before addition to cells. Preincubation of LL-37 with the mAb inhibited LL-37-induced ERK1/2 activation, whereas TGF-
-induced ERK1/2 activation was not affected by this monoclonal (Fig. 2C).
|
To study the involvement of EGFR signaling in LL-37-induced ERK1/2 activation, NCI-H292 cells were preincubated for 1 h with inhibitors of specific signaling molecules before adding LL-37 (Fig. 3). Both the EGFR tyrosine kinase inhibitor AG1478 and neutralizing anti-EGFR Abs were shown to inhibit LL-37-induced ERK1/2 activation, suggesting that EGFR signaling is involved in the process. The MAPK/ERK kinase (MEK) inhibitors U0126 and PD98059 blocked LL-37-induced ERK1/2 activation whereas the phosphatidylinositol 3-kinase inhibitor LY294002 had a minimal effect on LL-37-induced ERK1/2 activation. The antioxidants NAC and apocynin did not affect LL-37-induced ERK1/2 activation (data not shown), suggesting that reactive oxygen intermediates are not involved. Because metalloproteinases have been demonstrated to cleave EGFR ligands from their membrane-anchored forms and have in this way been shown to be involved in EGFR transactivation, the effect of the metalloproteinase inhibitor GM6001 was evaluated. GM6001 was shown to inhibit LL-37-induced ERK1/2 activation (Fig. 3), whereas it did not affect TGF-
-induced ERK1/2 activation (data not shown). To study involvement of EGFR ligands, neutralizing Abs against various EGFR ligands were tested for inhibition of LL-37-induced ERK1/2 activation. Anti-HB-EGF, anti-amphiregulin and anti-TGF-
neutralizing Abs alone did not significantly affect the process (data not shown). However, a mixture of the Abs blocked LL-37-induced ERK1/2 activation completely (Fig. 3).
|
To study the involvement of ERK1/2 activation in LL-37-induced IL-8 release, NCI-H292 cells were incubated for 1 h with inhibitors of separate signaling molecules before adding LL-37 and after 6 h, IL-8 release in cell-free supernatants was determined by IL-8-specific ELISA (Fig. 4). The MEK inhibitors U0126 and PD98059 completely inhibited LL-37-induced IL-8 release, suggesting that ERK1/2 is centrally involved in LL-37-induced IL-8 release. The EGFR tyrosine kinase inhibitor AG1478 also blocked LL-37-induced IL-8 release, suggesting a role for EGFR signaling in LL-37-induced IL-8 release. To study the involvement of metalloproteinases in LL-37-induced IL-8 release, the effect of the metalloproteinase inhibitor GM6001 was studied. GM6001 inhibited LL-37-induced IL-8 release, suggesting involvement of metalloproteinases in LL-37-induced IL-8 release.
|
To study the effect of LL-37 on activation of the MAPKs p38 and JNK, NCI-H292 cells were incubated with various concentrations of LL-37, or with TGF-
or TNF-
as a control. Both phosphorylated and total p38 and JNK levels were determined using Western blot analysis. LL-37 was shown to induce a concentration-dependent increase in p38 and JNK activation (Fig. 5). p38 Activation was demonstrated at 11 µg/ml LL-37, whereas JNK activation was demonstrated at a concentration of 33 µg/ml.
|
| Discussion |
|---|
|
|
|---|
|
helical peptide that shares structural and functional properties with LL-37 was shown to increase expression of selected genes, including various cell cycle inhibitors, in cells of a murine macrophage cell line (25). Finally, a very recent report showed that LL-37 increases chemokine production in mouse macrophages and the mouse lung, in the human lung alveolar epithelial cell line A549, and in whole blood (15). It therefore appears that the neutrophil may use various mediators to control the activity of epithelial and other cell types.
The mechanisms involved in mediating the previously mentioned effects of neutrophil-derived antimicrobial polypeptides on epithelial cells are largely unknown. In the present study, we have partially elucidated the mechanism involved in LL-37-induced epithelial cell activation, by demonstrating the involvement of metalloproteinase activity, EGFR ligands and the EGFR itself in this process. In addition to direct activation of the EGFR by its ligands, various other mechanisms may control EGFR activation. These include ligand-independent activation by, e.g., reactive oxygen intermediates (26, 27, 28). Our finding that the antioxidants NAC and apocynin do not affect LL-37-induced ERK1/2 activation suggest that this pathway is not involved in the epithelial cell activation by LL-37. In addition, ligand-dependent transactivation of the EGFR by cleavage of membrane-anchored EGFR ligands has been described. This latter mechanism was found to be used by GPCR as demonstrated by studies such as those by Prenzel et al. (29). These studies showed that GPCR may cause ligand-dependent transactivation of the EGFR via metalloproteinase-mediated cleavage of the membrane-anchored EGFR ligand HB-EGF. Subsequent studies identified members of "a disintegrin and metalloprotease" (ADAM) family to be involved in the GPCR-mediated cleavage of membrane-anchored EGFR ligands (30, 31). ADAMs are membrane-anchored metalloproteinases present on a large variety of cell types that display various functions, including cleavage of cytokines and growth factors and their receptors (reviewed in Ref. 32). ADAM9, ADAM10, and ADAM12 have been shown to be involved in cleavage of HB-EGF (30, 31, 33), whereas ADAM17/ TNF-
converting enzyme not only cleaves TNF-
, but is also involved in processing of precursor TGF-
(34). These data suggest that the metalloproteinase involved in LL-37-induced transactivation of EGFR in human bronchial epithelial cells is a member of the ADAM family. The mechanisms underlying ADAM activation and subsequent cleavage of membrane-bound ligands remain largely unknown. A recent study showed that the GPCR ligand bombesin increased ERK1/2 activation in COS7 cells, which was accompanied by complex formation between ADAM10 and HB-EGF (31). Therefore, because ERK1/2 activation by LL-37 takes place within minutes, LL-37 may regulate ADAM-metalloproteinase activation by promoting the association between ADAM-metalloproteinase and its EGFR ligand. The involvement of GPCR and/or G proteins in LL-37-induced transactivation of the EGFR remains to be established. Two studies have demonstrated the GPCR, FPRL1, as a receptor for LL-37. Both LL-37-induced chemotaxis (12) and endothelial proliferation (35) were shown to be mediated via the FPRL1. We studied the effects of a FPRL1-antagonistic peptide (tBoc peptide) on LL-37-induced activation of airway epithelial cells, and did not observe an effect of this peptide on LL-37-induced activation of airway epithelial cells. In addition, fMLP itself did not activate NCI-H292 cells. These data suggest that the FPRL1 is not involved in LL-37-induced activation of airway epithelial cells (data not shown). This conclusion is furthermore supported by our observation that the G protein inhibitor pertussis toxin did not inhibit LL-37-induced ERK1/2 activation. This indicates that GPCR and/or G proteins may not be involved in LL-37-induced epithelial cell activation.
Several recent studies have highlighted the potential importance of transactivation of the EGFR via a metalloproteinase-dependent mechanism in various animal models and clinical situations. PGE2 activates EGFR and ERK2 mitogenic signaling pathways via metalloproteinase-dependent cleavage of TGF-
and was suggested to play a role in colon cancer growth and gastrointestinal hypertrophy (36). Keratinocyte migration in cutaneous wound healing was shown to be mediated via cleavage of membrane-anchored HB-EGF by metalloproteinases (37). Furthermore, stimulation of cardiac myocytes with GPCR ligands resulted in shedding of HB-EGF by metalloproteinases and cardiac myocyte hypertrophy, and in vivo studies in mice showed that the metalloproteinase-inhibitor KB-R8895 inhibits HB-EGF shedding and cardiac hypertrophy. The metalloproteinase involved in this process was identified as ADAM12 (30).
The ERK/MAPK cascade has been shown to be involved in a large variety of cellular activities, ranging from cell survival and proliferation to expression of proinflammatory cytokines (reviewed in Refs. 38 ,39). We demonstrated that LL-37-induced IL-8 production is at least partially mediated via ERK1/2 activation, as shown by the ability of the MEK inhibitors U0126 and PD98059 to inhibit LL-37-induced IL-8 release. In addition to activating ERK1/2, LL-37 was also found to cause phosphorylation of the MAPK p38 and JNK. Furthermore, the EGFR seems to be involved in LL-37-induced IL-8 release because the EGFR tyrosine kinase inhibitor AG1478 inhibited LL-37-induced IL-8 release. The involvement of ERK1/2 activation in IL-8 production has been demonstrated in studies investigating viral (40), IL-17 (41), or Utah Valley particulate matter (42) induced IL-8 release, and the EGFR has been shown to be involved in both ERK1/2 activation (36) and IL-8 release (43). In addition to the involvement of ERK1/2, we also found that metalloproteinase activity and EGFR are involved in LL-37-induced IL-8 release. We observed that both the EGFR tyrosine kinase inhibitor AG1478 and the metalloproteinase inhibitor GM6001 inhibit LL-37-induced IL-8 release. In addition, doxycyclin, an antibiotic reported to inhibit metalloproteinase activity and recently shown to inhibit cigarette smoke-induced mucin gene expression in bronchial epithelial cells (44), was found to inhibit LL-37-induced IL-8 release significantly (data not shown). These results suggest that the LL-37-induced cleavage of membrane-anchored EGFR ligands by metalloproteinases may increase IL-8 release from airway epithelial cells via activation of ERK1/2.
The effects of LL-37 on activation of airway epithelial cells may be relevant in vivo. Human CAP-18 has been shown to be present in neutrophils, and 106 neutrophils isolated from peripheral blood were shown to contain 0.627 µg hCAP-18 (1). Skin lesions from patients with psoriasis, a condition associated with increased expression of LL-37 in the skin, were found to contain LL-37 at a median concentration of 304 µM (45). Lung tissue and secretions may also contain substantial concentrations of LL-37. In situ hybridization studies of the conducting airways showed LL-37/hCAP-18 expression in the surface epithelia and in the submucosal glands (3). LL-37 was detected in bronchial alveolar lavage fluid (46), but its concentrations in bronchial alveolar lavage fluid were not determined. Finally, LL-37 was detected in tracheal aspirates of newborns at concentrations of
20 µg/ml, and LL-37 levels were demonstrated to be significantly increased in infants with pulmonary or systemic infections (47). These data indicate that epithelial cells in the skin and lung may be exposed to high concentrations of LL-37 in vivo. Based on these observations and our finding that LL-37 activates airway epithelial cells at concentrations >10 µg/ml, LL-37-induced epithelial cell activation may occur in vivo. Functionally, increased local release of LL-37 from neutrophils or epithelial cells following, for example, bacterial infection, may aid in killing microorganisms, but may also stimulate recruitment of other inflammatory cells. This recruitment may result from direct chemotactic activity of LL-37 or be mediated by its ability to stimulate chemokine release from epithelial cells. Previous data from our laboratory showed activation of airway epithelial cells by the antimicrobial and chemotactic neutrophil defensins (17, 21). This suggests that in addition to antimicrobial activity, antimicrobial peptides may communicate with host cells to regulate the immune reaction.
In summary, LL-37 was shown to activate airway epithelial cells as demonstrated by ERK1/2 activation and increased IL-8 release. Furthermore, this activation was shown to involve EGFR activation, metalloproteinase activity, and EGFR ligands. In addition to antimicrobial and chemotactic activity, LL-37 might play an important role in innate immunity by activating airway epithelial cells, suggesting that LL-37 plays a regulatory function in the antimicrobial and inflammatory response of airway epithelial cells. These observations and recent findings that show an association between LL-37 expression and human disease, suggest that LL-37 may form a target for new antimicrobial and anti-inflammatory treatment strategies for skin and lung disorders.
| Acknowledgments |
|---|
| Footnotes |
|---|
2 Address correspondence and reprint requests to Dr. G. Sandra Tjabringa, Department of Pulmonology, Leiden University Medical Center, Building 1, C3-P, P.O. Box 9600, NL-2300 RC Leiden, The Netherlands. E-mail address: G.S.Tjabringa{at}LUMC.nl ![]()
3 Abbreviations used in this paper: hCAP, human cathelicidin cationic antimicrobial protein; FPRL, formyl peptide receptor-like; MAPK, mitogen-activated protein kinase; ERK, extracellular signal-regulated kinase; MEK, MAPK/ERK kinase; EGFR, epidermal growth factor receptor; PBEC, primary bronchial epithelial cell; NAC, N-acetylcysteine; HB, heparin-binding; JNK, c-Jun N-terminal kinase; GPCR, G protein-coupled receptor; ADAM, a disintegrin and metalloprotease. ![]()
Received for publication November 22, 2002. Accepted for publication October 1, 2003.
| References |
|---|
|
|
|---|
by blocking the binding of LPS to CD14+ cells. J. Immunol. 167:3329.
-helical cationic antimicrobial peptide selectively modulates macrophage responses to lipopolysaccharide and directly alters macrophage gene expression. J. Immunol. 165:3358.
/ADAM9 and PKC
are involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor. EMBO J. 17:7260.[Medline]
, epidermal growth factor and transforming growth factor-
on interleukin-8 production by, and human rhinovirus replication in, bronchial epithelial cells. Int. Immunopharmacol. 1:1229.[Medline]
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |