The JI
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     
 


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow Request Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Scott, M. G.
Right arrow Articles by Hancock, R. E. W.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Scott, M. G.
Right arrow Articles by Hancock, R. E. W.
The Journal of Immunology, 2002, 169: 3883-3891.
Copyright © 2002 by The American Association of Immunologists

The Human Antimicrobial Peptide LL-37 Is a Multifunctional Modulator of Innate Immune Responses1

Monisha G. Scott*, Donald J. Davidson*,{dagger}, Michael R. Gold*, Dawn Bowdish* and Robert E. W. Hancock2,*

* Department of Microbiology and Immunology and {dagger} British Columbia Research Institute for Child and Family Health, University of British Columbia, Vancouver, British Columbia, Canada


    Abstract
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
The role of LL-37, a human cationic antimicrobial peptide, in the immune system is not yet clearly understood. It is a widely expressed peptide that can be up-regulated during an immune response. In this report, we demonstrate that LL-37 is a potent antisepsis agent with the ability to inhibit macrophage stimulation by bacterial components such as LPS, lipoteichoic acid, and noncapped lipoarabinomannan. We also demonstrate that LL-37 protects mice against lethal endotoxemia. In addition to preventing macrophage activation by bacterial components, we hypothesized the LL-37 may also have direct effects on macrophage function. We therefore used gene expression profiling to identify macrophage functions that might be modulated by LL-37. These studies revealed that LL-37 directly up-regulates 29 genes and down-regulated another 20 genes. Among the genes predicted to be up-regulated by LL-37 were those encoding chemokines and chemokine receptors. Consistent with this, LL-37 up-regulated the expression of chemokines in macrophages and the mouse lung (monocyte chemoattractant protein 1), human A549 epithelial cells (IL-8), and whole human blood (monocyte chemoattractant protein 1 and IL-8), without stimulating the proinflammatory cytokine, TNF{alpha}. LL-37 also up-regulated the chemokine receptors CXCR-4, CCR2, and IL-8RB. These findings indicate that LL-37 may contribute to the immune response by limiting the damage caused by bacterial products and by recruiting immune cells to the site of infection so that they can clear the infection.


    Introduction
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Cationic antimicrobial peptides, components of the innate host defenses of many species, have broad-spectrum activity against bacteria, fungi, parasites, and viruses (1, 2). They also have an affinity for LPS (3, 4, 5, 6). Such cationic peptides can suppress cytokine production in response to endotoxic LPS and to varying extents can prevent lethal endotoxemia (7, 8, 9). It is becoming increasingly clear that antimicrobial peptides are a major player in local innate immunity, especially at mucosal and epithelial surfaces (2, 10). In the fruit fly Drosophila, peptides are recognized as the major form of defense against infection and are induced, in response to challenge by microbes or microbial signaling molecules like LPS, by a regulatory pathway similar to that used by the mammalian immune system (involving Toll receptors and the transcription factor NF-{kappa}B (11). Evidence for the key role of cationic antimicrobial peptides in innate immunity includes mutations affecting the induction of antibacterial peptides which reduce survival in response to bacterial challenge. Indeed mutations of the Toll pathway of Drosophila that lead to decreased antifungal peptide gene expression result in increased susceptibility to lethal fungal infections (12). Although there are multiple defensins in mice, Wilson et al. (13) identified the single enzyme necessary for processing the preprodefensins to the active mature form. Genetic inactivation of this single gene (matrilysin) led to no production of active defensin in the small intestine and a consequent 10-fold increase in the susceptibility to infection by orally introduced virulent bacteria (13). Patients with specific granule deficiency syndrome, completely lacking in {alpha} defensins, suffer from frequent and severe bacterial infections (2, 14). Similarly, a group of HIV patients with lower salivary levels of histatin peptides showed a higher incidence of oral candidiasis and fungal infection (2). Other evidence includes the inducibility of some peptides by infectious agents and the very high concentrations that have been recorded at sites of inflammation (15, 16, 17).

The single known human cathelicidin, hCAP-18, is a major protein of the specific granules in neutrophils (18) and is also present in monocytes and certain lymphocyte populations (19), testis (20), human keratinocytes during inflammatory disorders (21), and airway epithelium (22). The characteristic feature of cathelicidin peptides is a high level of sequence identity at the N terminus prepro regions (23), termed the cathelin domain (24). Cathelicidin peptides are stored as inactive propeptide precursors that, upon stimulation, are processed into active peptides. hCAP-18 was found to be cleaved extracellularly by proteinase 3 to generate the peptide LL-37 (25). Overexpression of this peptide, by adenovirus-mediated gene transfer, of LL-37 in the mouse airway results in the increased ability to reduce bacterial load from Pseudomonas aeruginosa challenge and improved survival after administration of lethal doses of LPS (26). It is of interest to determine whether the natural role of peptides in the body involves direct bacterial killing or a combination of killing and stimulation of other mechanisms of innate immunity.

Cationic antimicrobial peptides may also regulate cell migration to promote the ability of leukocytes to combat bacterial infections. For example, two human {alpha} defensin peptides, HNP-1 and HNP-2, have been indicated to have direct chemotactic activity for murine and human T cells and monocytes (27, 28), and human {beta} defensins appear to act as chemoattractants for immature dendritic cells and memory T cells through interaction with CCR6 (29). Similarly, the porcine cationic peptide PR-39 was found to be chemotactic for neutrophils (30). LL-37 has been shown to have chemotactic activity for monocytes, T cells, and neutrophils (31, 32) as well as mast cells (33).

The aim of our current study was to gain knowledge of the roles that the human peptide LL-37 may play in combating bacterial infection. We performed gene arrays on macrophage cells stimulated with LL-37 and discovered a large number of genes affected by the peptide. A number of LL-37-induced gene expression changes were confirmed by semiquantitative RT-PCR. We chose to follow-up on several genes up-regulated by LL-37 that are involved in chemotaxis. We report here the novel finding that LL-37 up-regulates the production of chemokines and the surface expression of chemokine receptors, and thus could promote cell migration, and that this occurs in vivo in the mouse lung. These properties are in addition to the ability of LL-37 to reduce the production of TNF-{alpha} by macrophages stimulated with LPS, lipoteichoic acid (LTA),3 and Mycobacterium noncapped lipoarabinomannan (AraLAM) suggesting that LL-37 has a multifaceted role in controlling bacterial infection.


    Materials and Methods
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Reagents

Salmonella typhimurium LPS and Escherichia coli 0111:B4 LPS were purchased from Sigma-Aldrich (St. Louis, MO). LTA (Sigma) from Staphylococcus aureus was resuspended in endotoxin-free water (Sigma-Aldrich). The Limulus amebocyte lysate assay (Sigma-Aldrich) was performed on LTA preparations to confirm that lots were not significantly contaminated by endotoxin. Endotoxin contamination was <1 ng/ml, a concentration that did not cause significant cytokine production in the RAW 264.7 cells (34). AraLAM was a gift from Dr. J. T. Belisle of Colorado State University (Fort Collins, CO). The AraLAM from Mycobacterium was filter sterilized and the endotoxin contamination was found to be 3.75 ng per 1.0 mg of LAM as determined by the Limulus amebocyte assay. LL-37 (amino acid sequence: [LL-37, 37 aa]) was synthesized by F-moc chemistry at the Nucleic Acid/Protein Synthesis Unit at the University of British Columbia (UBC) as described previously (8).

Preparation and analysis of macrophages isolated from bone marrow of mice

Bone marrow macrophages were obtained from 8- to 10-wk-old BALB/c mice (Charles River Breeding Laboratories, Wilmington, MA) as previously described (35). The cells were cultured in 150-mm plates in DMEM (Life Technologies, Burlington, Ontario, Canada) supplemented with 20% FBS (Sigma-Aldrich) and 20% L cell-conditioned medium as a source of M-CSF. Once macrophages were 60–80% confluent, they were deprived of L cell-conditioned medium for 14–16 h to render the cells quiescent. The experiments were then conducted by adding 100 ng/ml E. coli O111:B4 LPS, LPS plus 20 µg/ml LL-37 (or CEMA), or medium alone (DMEM plus 20% FBS) to the cells for 24 h. The release of cytokines into the culture supernatant was determined by ELISA (R&D Systems, Minneapolis, MN).

Cytokine and chemokine production by RAW 264.7 macrophages and A549 epithelial cells

The murine macrophage cell line RAW 264.7 was obtained from American Type Culture Collection (Manassas, VA) and the human epithelial cell line A549 was obtained from Dr. D. Speert (Department of Pediatrics, UBC). Both cell lines were maintained in DMEM supplemented with 10% FCS. RAW 264.7 cells were seeded in 24-well plates at a density of 106 cells/well in DMEM (see above) and A549 cells were seeded in 24-well plates at a density of 105 cells/well in DMEM (see above), and both were incubated at 37°C in 5% CO2 overnight. DMEM was aspirated from cells grown overnight and replaced with fresh medium. LPS or other bacterial products were incubated with the cells for 6–24 h at 37°C in 5% CO2. At the same time as LPS addition, cationic peptides were added at a range of concentrations. The supernatants were removed and tested for cytokine or chemokine production by ELISA (R&D Systems).

Chemokine production in whole blood

Blood from volunteer human donors was collected (according to procedures accepted by UBC Clinical Research Ethics Board, certificate C00-0537) by venipuncture into tubes (BD Labware, Franklin Lakes, NJ) containing 14.3 USP units heparin/ml blood. The blood was mixed with increasing concentrations of LL-37 in polypropylene tubes at 37°C for 6 h. The samples were centrifuged for 5 min at 2000 x g, and the plasma was collected and then stored at -20°C until analyzed for monocyte chemoattractant protein (MCP) 1, TNF-{alpha}, and IL-8 by ELISA (R&D Systems).

RNA isolation

RAW 264.7 cells were plated in 150-mm tissue culture dishes at 5.6 x 106 cells/dish, cultured overnight, and then incubated with 50 µg/ml LL-37 or medium alone for 4 h. After stimulation, the cells were washed once with diethyl pyrocarbonate-treated PBS, and detached from the dish using a cell scraper. Total RNA was isolated using TRIzol (Life Technologies) as described previously (1, 36). The quality of the RNA was assessed by gel electrophoresis on a 1% agarose gel. RNA samples were treated with DNase according to the manufacturer’s instructions (DNA free; Ambion, Austin, TX) to remove any contaminating genomic DNA. Lack of genomic DNA contamination was confirmed by using the isolated RNA as a template for PCR amplification with {beta}-actin-specific primers (5'-GTCCCTGTATGCCTCTGGTC-3' and 5'-GATGTCACGCACGATTTCC-3'). Agarose gel electrophoresis and ethidium bromide staining confirmed the absence of an amplicon after 35 cycles.

Mouse cDNA expression arrays

Atlas cDNA Expression Arrays (Clontech Laboratories, Palo Alto, CA), which consist of 588 selected mouse cDNAs spotted in duplicate on positively charged membranes, were used for our gene array studies as described previously (1). Briefly, 32P-radiolabeled cDNA probes were prepared from 5 µg total RNA that was incubated overnight at 71°C. The filters were washed extensively and then exposed to a PhosphorImager screen (Molecular Dynamics, Sunnyvale, CA) for 3 days at 4°C. The image was captured using a Molecular Dynamics PSI phosphoimager. The hybridization signals were analyzed using Atlas Image 1.0 Image Analysis software (Clontech Laboratories) and Excel (Microsoft, Redmond, WA). The intensities for each spot were corrected for background levels and normalized for differences in probe labeling using the average values for five genes observed to vary little among our stimulation conditions: {beta}-actin, ubiquitin, ribosomal protein S29, GAPDH, and Ca2+-binding protein. When the normalized hybridization intensity for a given cDNA was <20, it was assigned a value of 20 to calculate the ratios and relative expression (1, 36).

Semiquantitative RT-PCR

RNA was prepared as described above. The 1-µg RNA samples were incubated with 1 µl oligo(dT) (500 µg/ml) and 1 µl mixed dNTP stock at 1 mM in a 12-µl volume with diethyl pyrocarbonate-treated water at 65°C for 5 min in a thermocycler. Briefly, 4 µl 5x first-strand buffer, 2 µl 0.1 M DTT, and 1 µl RNaseOUT recombinant ribonuclease inhibitor (40 U/µl) were added and incubated at 42°C for 2 min, followed by the addition of 1 µl (200 U) of Superscript II (Invitrogen, Burlington, Ontario, Canada). Negative controls for each RNA source were generated using parallel reactions in the absence of Superscript II. cDNAs were amplified in the presence of 5' and 3' primers (1.0 µM), 0.2 mM dNTP mixture, 1.5 mM MgCl, 1 U Taq DNA polymerase (New England Biolabs, Mississauga, Ontario, Canada), and 1x PCR buffer. Each PCR was performed with a thermal cycler by using 30–40 cycles consisting of 30 s of denaturation at 94°C, 30 s of annealing at either 52 or 55°C and 40 s of extension at 72°C. The number of cycles of PCR was optimized to lie in the linear phase of the reaction for each primer and set of RNA samples. A housekeeping gene, {beta}-actin, was amplified in each experiment to evaluate extraction procedure and to estimate the amount of RNA. The reaction product was visualized by electrophoresis and analyzed by densitometry, with relative starting RNA concentrations calculated with reference to {beta}-actin amplification. The primers used are shown in Table IGo.


View this table:
[in this window]
[in a new window]
 
Table I. Primer pairs for RT-PCR

 
Flow cytometry

To analyze cell surface expression of IL-8RB, CXCR-4, and CCR2, RAW 264.7 macrophage cells were stained with 10 µg/ml of the appropriate primary Ab (Santa Cruz Biotechnology, Santa Cruz, CA) followed by FITC-conjugated goat anti-rabbit IgG (IL-8RB and CXCR-4; Jackson ImmunoResearch Laboratories, West Grove, PA) or FITC-conjugated donkey anti-goat IgG (Santa Cruz Biotechnology). The cells (10,000 live events were counted) were passed through a FACscan (BD Biosciences, Mountain View, CA) and forward and side scatter were used to gate on live cells.

Measurement of LL-37-induced chemokine production in the respiratory tract of mice

Animal studies were approved by the UBC Animal Care Committee (UBC ACC no. A01-0008). BALB/c mice were purchased from Charles River Breeding Laboratories and housed in standard animal facilities. Age-, sex-, and weight-matched adult mice were anesthetized with an i.p. injection of Avertin (4.4 mM 2,2,2-tribromoethanol, 2.5% 2-methyl-2-butanol, in distilled water) using 200 µl/10 g body weight. The instillation was performed using a nonsurgical, intratracheal instillation method adapted from Ho and Furst (37). Briefly, the anesthetized mouse was placed with its upper teeth hooked over a wire at the top of a support frame with its jaw held open and a spring pushing the thorax forward to position the pharynx, larynx, and trachea in a vertical straight line. The airway was illuminated externally and an intubation catheter was inserted into the clearly illuminated tracheal lumen. A 50-µg bolus of LL-37 suspended in 20 µl of sterile water, or sterile water alone, was placed in a well at the proximal end of the catheter and gently instilled into the trachea with 200 µl of air. The animal was maintained in an upright position for 2 min after instillation to allow the fluid to drain into the respiratory tree. After 4 h, the mice were euthanized by i.p. injection of 300 mg/kg pentobarbital. The trachea was exposed and an i.v. catheter was passed into the proximal trachea and tied in place with suture thread. Lavage was performed by introducing 0.75 ml sterile PBS into the lungs via the tracheal cannula and then after a few seconds, withdrawing the fluid. This was repeated three times with the same sample of PBS. The lavage fluid was placed in a tube on ice and the total recovery volume per mouse was ~0.5 ml. The bronchoalveolar lavage (BAL) fluid was centrifuged at 1200 rpm for 10 min and the clear supernatant removed and tested for TNF-{alpha} and MCP-3 by ELISA.


    Results
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
LL-37 neutralizes the activation of macrophages by LPS, LTA, and AraLAM

Cationic antimicrobial peptides have been shown to block many LPS-induced responses and are being considered as candidates for the treatment of sepsis. We have previously shown that CEMA (a synthetic peptide derived from the sequence of cecropin and melittin) blocks LPS-induced production of inflammatory cytokines and selectively inhibits the ability of LPS to alter gene expression in the RAW 264.7 murine macrophage cell line (8, 36). Although CEMA reduced LPS-induced up-regulation of >40 genes, including many genes encoding inflammatory mediators, the regulation of 16 other genes by LPS was unaffected by CEMA. Thus, we proposed that cationic antimicrobial peptides selectively down-regulate the proinflammatory responses of macrophages to LPS while leaving certain other responses intact. It appears possible that naturally occurring cationic antimicrobial peptides normally play such a role in either limiting or terminating inflammatory responses. Therefore, we wished to analyze the effects of a human cationic antimicrobial peptide, LL-37, on macrophage responses to LPS and other bacterial products.

The extensively studied RAW 264.7 macrophage cell line was used to determine whether the LL-37 could inhibit the production of TNF-{alpha} by macrophages stimulated with bacterial products. The RAW 264.7 cells were incubated with three types of LPS, with LTA, or with AraLAM and then the release of TNF-{alpha} into the culture supernatants was quantitated by ELISA. We used these bacterial products to represent products release by both Gram-negative and Gram-positive bacteria. LL-37 was able to significantly inhibit TNF-{alpha} production stimulated by S. typhimurium, Burkholderia cepacia, and E. coli O111:B4 LPS, with the former being affected to a somewhat lesser extent (Fig. 1GoA). At concentrations as low as 1 µg/ml LL-37 (0.25 nM), substantial inhibition of TNF-{alpha} production was observed in the latter two cases. These results were confirmed in primary cells, in that LL-37 and the positive control peptide CEMA significantly inhibited TNF-{alpha} production (>90%) by bone marrow-derived macrophages from BALB/c mice that had been stimulated with 100 ng/ml E. coli 0111:B4 LPS (Fig. 1GoB). These experiments were performed in the presence of serum, which contains LPS-binding protein (LBP), a protein that can mediate the rapid binding of LPS to CD14. Thus, we examined the kinetics of antagonism of LPS induction of TNF-{alpha} production (Fig. 1GoC). Delayed addition of LL-37 to the supernatants of macrophages 1 h after stimulation with 100 ng/ml E. coli LPS still resulted in substantial reduction of TNF-{alpha} production (70%).



View larger version (39K):
[in this window]
[in a new window]
 
FIGURE 1. LL-37 reduces LPS-induced production of TNF-{alpha}. A, RAW 264.7 macrophage cells were stimulated with ({blacksquare}) 100 ng/ml S. typhimurium LPS, ({blacktriangleup}) 100 ng/ml B. cepacia LPS, and (•) 100 ng/ml E. coli 0111:B4 LPS in the presence of the indicated concentrations of LL-37 for 6 h. The concentrations of TNF-{alpha} released into the culture supernatants were determined by ELISA. One hundred percent represents the amount of TNF-{alpha} resulting from RAW 264.7 cells incubated with LPS alone for 6 h (S. typhimurium LPS, 34.5 ± 3.2 ng/ml; B. cepacia LPS, 11.6 ± 2.9 ng/ml; and E. coli 0111:B4 LPS, 30.8 ± 2.4 ng/ml). Background levels of TNF-{alpha} production by the RAW 264.7 cells cultured with no stimuli for 6 h resulted in TNF-{alpha} levels ranging from 0.037 to 0.192 ng/ml. The data are from duplicate samples and presented as the mean of three experiments ± SE. B, Bone marrow-derived macrophages were cultured for either 6 or 24 h with 100 ng/ml E. coli 0111:B4 LPS in the presence or absence of 20 µg/ml LL-37 or CEMA. The supernatant was collected and tested for levels of TNF-{alpha} by ELISA. One hundred percent represents the amount of TNF-{alpha} resulting from duplicate wells of bone marrow-derived macrophages incubated with LPS alone for 6 h (1.1 ± 0.09 ng/ml) or 24 h (1.7 ± 0.2 ng/ml). Background levels of TNF-{alpha} were 0.038 ± 0.008 ng/ml for 6 h and 0.06 ± 0.012 ng/ml for 24 h. The data from duplicate samples are presented as the mean of three experiments + SE. C, LL-37 (20 µg/ml) was added at increasing time points to wells already containing 100 ng/ml E. coli 0111:B4 LPS. The supernatant was collected after 6 h and tested for levels of TNF-{alpha} by ELISA. The data are presented as the mean of three experiments + SE. D, A549 cells were stimulated with increasing concentrations of LL-37 in the presence of LPS (100 ng/ml E. coli O111:B4) for 24 h. The concentration of IL-8 ({blacktriangleup}) and MCP-1 (•) in the culture supernatants was determined by ELISA. The background levels of IL-8 from cells alone was 0.172 ± 0.029 ng/ml and the background levels of human MCP-1 was 1.08 ± 0.12 ng/ml. The data are presented as the mean of three experiments + SE.

 
Consistent with the ability of LL-37 to prevent LPS-induced production of TNF-{alpha} in vitro, LL-37 partially protected mice against lethal endotoxic shock induced by a high concentration of endotoxin (LPS). CD-1 mice were sensitized to endotoxin with a prior injection of galactosamine. Mice that were injected with 3 µg of E. coli 0111:B4 LPS were all killed within 4–6 h. When 200 µg of LL-37 was injected 15 min after the LPS, 50% of the mice survived (Table IIGo).


View this table:
[in this window]
[in a new window]
 
Table II. Protection against lethal endotoxemia in galactosamine-sensitized CD-1 mice by LL-37a

 
LL-37 could also reduce the ability of bacterial products to stimulate the production of inflammatory mediators by an epithelial cell line. In the A549 human lung epithelial cell line, LL-37 reduced the ability of LPS to stimulate the production of IL-8 and MCP-1 (Fig. 1GoD).

Since LL-37 was able to inhibit LPS-induced TNF-{alpha} production, we asked whether it could inhibit the ability of other bacterial products to induce TNF-{alpha} release. We therefore examined whether LL-37 would block the ability of Mycobacterium noncapped AraLAM and S. aureus LTA to activate RAW 264.7 cells. LL-37 and CEMA did indeed reduce induction of TNF-{alpha} in RAW 264.7 cells by AraLAM (Fig. 2Go). At a concentration of 1 µg/ml, LL-37 was able to substantially inhibit (>75%) the induction of TNF-{alpha} production by 1 µg/ml S. aureus LTA. At 20 µg/ml LL-37, there was >60% inhibition of AraLAM-induced TNF-{alpha}. Polymyxin B was included as a control to demonstrate that contaminating endotoxin was not a significant factor in the inhibition of AraLAM-induced TNF-{alpha} by LL-37. These studies demonstrated that the human peptide LL-37 can neutralize the effect of bacterial products on the immune system and may aid the immune response to bacterial infection by modulating the immune response to bacterial products released upon infection.



View larger version (12K):
[in this window]
[in a new window]
 
FIGURE 2. Inhibition of TNF-{alpha} production by RAW 264.7 macrophages stimulated with S. aureus LTA and Mycobacterium AraLAM by LL-37. RAW 264.7 macrophage cells were stimulated with 1 µg/ml S. aureus LTA (A) and 1 µg/ml AraLAM LPS (B) in the absence and presence of 20 µg/ml LL-37 or polymyxin B (PB). The supernatant was collected and tested for levels of TNF-{alpha} by ELISA. Background levels of TNF-{alpha} production by the RAW 264.7 cells cultured with no stimuli for 6 h resulted in TNF-{alpha} levels ranging from 0.037 to 0.192 ng/ml. The data are presented as the mean of three or more experiments + SE.

 
LL-37 alters macrophage transcriptional responses

We hypothesized that LL-37 could affect other macrophage functions as we had previously observed with CEMA (1). We therefore performed gene array studies to determine the transcriptional responses of macrophages to LL-37. RNA was extracted from RAW 264.7 cells that were cultured for 4 h with medium alone or 50 µg/ml LL-37 alone and converted into 32P-labeled cDNA. The hybridization of the cDNA probes to each immobilized DNA was visualized by autoradiography and quantified using a PhosphorImager. Representative autoradiographic images of the gene arrays are shown in Fig. 3Go. Table IIIGo shows that LL-37 treatment of RAW 264.7 cells up-regulated the expression of at least 30 different genes. The genes up-regulated by LL-37 were mainly from two categories: one that includes receptors (growth, chemokine, IL, IFN, hormone, neurotransmitter), cell surface Ags, and cell adhesion and another one that includes cell-cell communication (growth factors, cytokines, chemokines, IL, IFN, hormones), cytoskeleton, motility, and protein turnover. The specific genes up-regulated included those encoding chemokine MCP-3, the anti-inflammatory cytokine IL-10, M-CSF, and receptors such as IL-1R2 (a putative antagonist of productive IL-1 binding to IL-1R1), platelet-derived growth factor receptor B, NOTCH4, LIF receptor, LFA-1, TGF-{beta} receptor 1, G-CSF receptor, and IFN-{gamma} receptor. Our gene array data suggested that LL-37 up-regulates the expression of the chemokine receptors IL-8RB, CXCR-4, and CCR2 by 10-, 4-, and 1.4-fold above unstimulated cells, respectively. To confirm our gene array data, we examined, using flow cytometry, the surface expression of these receptors on RAW cells stimulated with peptide for 4 h. When 50 µg/ml LL-37 was incubated with RAW cells for 4 h, IL-8RB was up-regulated an average of 2.4-fold above unstimulated cells, CXCR-4 was up-regulated an average of 1.6-fold above unstimulated cells, and CCR2 was up-regulated 1.8-fold above unstimulated cells (data not shown). As a control we demonstrated that CEMA caused similar up-regulation. LL-37 also up-regulated genes encoding several metalloproteinases and inhibitors thereof, including the bone morphogenetic proteins bone morphogenetic protein (BMP) 1, BMP-2, BMP-8a, tissue inhibitor of matrix metalloproteinase 2, and tissue inhibitor of matrix metalloproteinase 3. As well, LL-37 up-regulated specific transcription factors, including JunD, and the YY and LIM-1 transcription factors, and kinases such as Etk1 and Csk, demonstrating its widespread effects. We also discovered from our gene array studies that LL-37 down-regulated at least 20 genes in RAW macrophage cells (Table IVGo). The genes down-regulated by LL-37 included DNA repair proteins and several inflammatory mediators such as macrophage-inflammatory protein (MIP) 1{alpha}, oncostatin M, and IL-12.



View larger version (87K):
[in this window]
[in a new window]
 
FIGURE 3. Effect of LL-37 on gene expression in RAW 264.7 macrophage cells. RAW 264.7 macrophage cells were stimulated with medium alone (A) for 4 h or 50 µg/ml LL-37 (B). The RNA was isolated from the cells with TRIzol, DNase treated, and used to make 32P-labeled cDNA probes, which were hybridized to the Clontech Atlas arrays. After a 3-day exposure, they were analyzed using a PhosphorImager and Clontech Atlas software. These data are representative of three experiments.

 

View this table:
[in this window]
[in a new window]
 
Table III. Genes up-regulated by LL-37 treatment of RAW 264.7 macrophage cellsa

 

View this table:
[in this window]
[in a new window]
 
Table IV. Genes down-regulated by LL-37 treatment of RAW 264.7 macrophage cellsa

 
Confirmation of LL-37-altered macrophage transcriptional responses

The changes in gene expression in RAW 264.7 cells in response to LL-37 compared with medium-only controls were also confirmed for a number of genes by semiquantitative RT-PCR (Fig. 4Go). These included genes that were up- and down-regulated or unchanged. The chemokine receptors CXCR-4 and IL-8RB were up-regulated to similar extents by gene arrays and RT-PCR. CXCR-4 was up-regulated by LL-37 relative to medium-only controls, 4 ± 1.7-fold by gene arrays, and 4.1 ± 0.9-fold by RT-PCR, and IL-8RB was up-regulated 9.5 ± 7.6-fold (average ± SE) by gene arrays and 7.1 ± 1.4-fold by RT-PCR. The relative expression of CD14 was 0.9 ± 0.1-fold and 0.8 ± 0.3-fold by gene arrays and RT-PCR, respectively. MCP-1, which was not on the gene arrays but whose expression was followed up at the protein level (Fig. 5Go), was found to be up-regulated 3.5 ± 1.4-fold by RT-PCR. However, there was a disparity in the recorded levels of expression of IL-10, MCP-3, cyclin D1, and MIP-1{beta} (Fig. 4Go) after LL-37 treatment relative to medium control in gene array and RT-PCR experiments indicating that the array methodology provides qualitative rather than quantitative data. Although the changes in RNA levels for a number of genes in RAW 264.7 cells treated with LL-37 were confirmed, it should be noted that this could be the result of either an increase/decrease in transcription or change in RNA stability.



View larger version (29K):
[in this window]
[in a new window]
 
FIGURE 4. Confirmation of LL-37 induced macrophage gene expression changes by RT-PCR. RAW 264.7 macrophage cells were incubated with 50 µg/ml LL-37 or medium only for 4 h. Semiquantitative RT-PCR was performed on total RNA isolated from the RAW 264.7 cells. Specific primer pairs for each gene (Table IGo) were used for amplification of RNA. Amplification of {beta}-actin was used as a positive control and for standardization. A, The products for medium-only-treated cells and LL-37-treated cells are shown in the first and second lane for each gene. Lanes 1 and 2, {beta}-Actin; lanes 3 and 4, XRCC1; lanes 5 and 6, MIP-1{beta}; lanes 7 and 8, CD14; lanes 9 and 10, cyclin D1; and lanes 11 and 12, IL-8RB. B, Densitometric analysis of each gene was performed. The relative fold change refers to the change in gene expression of LL-37-treated cells compared with cells incubated with medium alone. {blacksquare}, The results from gene array experiments; , results from RT-PCR experiments. The data are presented as the mean ± SE of three experiments.

 


View larger version (20K):
[in this window]
[in a new window]
 
FIGURE 5. Induction of MCP-1 in RAW 264.7 macrophage cells and whole human blood. RAW 264.7 macrophage cells or whole human blood were stimulated with increasing concentrations of LL-37 for 4 h. The human blood samples were centrifuged and the serum was removed and tested for MCP-1 by ELISA along with the supernatants from the RAW cells. The RAW cell data presented are the mean of three or more experiments ± SE and the human blood data represent the mean ± SE from three separate donors.

 
LL-37 induces chemokine secretion

Our gene array studies indicated that LL-37 increased the expression of chemokine genes in RAW 264.7 cells. This suggests that LL-37 may induce macrophages to produce chemokines, which could in turn recruit additional immune cells to the sites of infection. We went on to confirm the up-regulation of chemokines in several different systems. First, we examined the effect of LL-37 on RAW 264.7 cell production of MCP-1 (MCP-1 was not represented on our arrays but has similar activities to MCP-3 for which no ELISA is available). The murine MCP-1, a homologue of the human MCP-1, is a member of the {beta}(C-C) chemokine family. MCP-1 has been demonstrated to recruit monocytes (38), NK cells (39), and some T lymphocytes (40). When RAW macrophages were stimulated with increasing concentrations of LL-37, they produced significant levels of MCP-1 in their supernatant, as judged by ELISA (Fig. 4Go). RAW264.7 cells stimulated with peptide concentrations ranging from 20 to 50 µg/ml for 24 h produced significant levels of MCP-1 (200–400 pg/ml above background). When the cells were stimulated with 100 µg/ml LL-37, very high levels of MCP-1 (>1000 pg/ml above background) were produced. The ability of LL-37 to induce human MCP-1 in blood was also tested. Human blood from three separate donors was incubated with LL-37 for 4 h, the samples were centrifuged, and the serum was removed and tested for human MCP-1 by ELISA. Although there was significant production of human MCP-1 in response to LL-37 by all three donors, there was substantial variation of donor response to the peptide, as indicated by the large SE in Fig. 5Go.

We also examined the effect of LL-37 on chemokine induction in a completely different cell system, A549 human epithelial cells. Interestingly, although these cells produce MCP-1 in response to LPS (Fig. 1GoD) and this response could be antagonized by LL-37, there was no production of MCP-1 in direct response to LL-37. LL-37 did however induce production of IL-8, a neutrophil-specific chemokine (Fig. 6GoA). Thus, LL-37 can induce a different spectrum of responses from different cell types. Significant but low levels of IL-8 were produced at LL-37 concentrations of 20 µg/ml. At 100 µg/ml LL-37, there were high levels of IL-8 produced (>1 ng/ml). This is in contrast to another cationic {alpha} helical peptide that was tested and found not to cause induction of IL-8 (data not shown), suggesting that the effect of LL-37 is specific. LL-37 also induced significant levels of IL-8 in whole human blood (Fig. 6GoA). Since LPS is a known potent stimulus of IL-8 production and LL-37 neutralized the responses of LPS (Fig. 1GoD), we studied the direct effect of LL-37 on LPS-induced IL-8 production in A549 cells. We confirmed that at low concentrations of LL-37 (1–20 µg/ml), the peptide inhibited the LPS-induced IL-8 production, but that at high concentrations of LL-37 (50–100 µg/ml), there was stimulation of IL-8 production independent of LPS. This indicates that LL-37 may have differential roles in the immune system depending on the concentration found at the site of infection.



View larger version (15K):
[in this window]
[in a new window]
 
FIGURE 6. Induction of IL-8 by A549 epithelial cells and whole human blood. A, A549 cells or whole human blood were stimulated with increasing concentrations of LL-37 for 24 and 4 h, respectively. The human blood samples were centrifuged and the serum was removed and tested for IL-8 by ELISA along with the supernatants from the A549 cells. The A549 cell data presented are the mean of three or more experiments ± SE and the human blood data represent the mean ± SE from three separate donors. B, A549 cells were stimulated with 100 ng/ml E. coli O111:B4 LPS (—) and LPS plus increasing concentrations of LL-37 (- - -) for 24 h. The supernatant was removed and tested for IL-8 by ELISA. This experiment was repeated four times and one representative experiment is shown.

 
LL-37 up-regulates the production of MCP-1 but not TNF-{alpha} in the BAL fluid of mice given LL-37 by intratracheal instillation

To examine the effects of LL-37 in an in vivo situation, BALB/c mice were given LL-37 or endotoxin-free water by intratracheal instillation and the levels of MCP-1 and TNF-{alpha} were examined in the BAL fluid after 3–4 h. We found that the mice treated with an intratracheal bolus of LL-37 produced significantly increased levels of MCP-1 over mice given water or anesthetic alone (Fig. 7Go). This was not a general proinflammatory response to LL-37 since no significant difference in BAL TNF-{alpha} was observed in peptide-treated mice when compared with mice given water or anesthetic alone. Furthermore, no significant induction of TNF-{alpha} production was observed in RAW 264.7 cells or bone marrow-derived macrophages treated with LL-37 (100 µg/ml LL-37 resulted in 0.033 ± 0.001 ng/ml TNF-{alpha}, medium alone resulted in 0.038 ± 0.008 ng/ml TNF-{alpha}). No decrease in the viability of RAW 264.7 cells was observed in the presence of serum with up to 125 µg/ml LL-37 as measured by the MTT assay (data not shown). Thus, LL-37 selectively induces the production of chemokines without inducing the production of inflammatory mediators such as TNF-{alpha}. This illustrates the dual role of LL-37 as a factor that can block bacterial product-induced inflammation while helping to recruit phagocytes that can augment clearance of bacterial infections.



View larger version (17K):
[in this window]
[in a new window]
 
FIGURE 7. Production of MCP-1 and TNF-{alpha} in murine BAL fluid in response to LL-37. BALB/c mice were anesthetized with avertin and given intratracheal instillation of LL-37 or water or no instillation (no treatment). The mice were monitored for 4 h, anesthetized, and the BAL fluid was isolated and analyzed for MCP-1 and TNF-{alpha} concentrations by ELISA. The data shown are the mean of four or five mice for each condition ± SE.

 

    Discussion
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
The role of cationic antimicrobial peptides in antimicrobial defenses has become increasingly apparent. For example, in a mouse endotoxemia model, treatment with the insect-derived peptide CEMA dramatically suppressed the LPS-stimulated induction of the important sepsis-mediating cytokine TNF-{alpha} (8). The antiendotoxin activity of CEMA could be partially attributed to its ability to block the interaction of LPS with LBP (41) and its ability to selectively suppress LPS-induced macrophage gene expression (36). We found here that the human peptide LL-37, when added to macrophages stimulated with bacterial products, was able to reduce the production of the proinflammatory cytokine TNF-{alpha}. By binding bacterial products and reducing their ability to stimulate macrophages, LL-37 could reduce the development of sepsis in moderate infections. We have previously shown that other cationic antimicrobial peptides bind to LPS and inhibit its binding to LBP (41). Thus, cationic peptides provide not only a natural response to bacterial infection, as seen with LL-37, but also a possible therapeutic intervention. LL-37 could help not only limit bacterial infection but also prevent an overwhelming immune response that can lead to sepsis and even death. Their ability to block macrophage activation suggests that they have a role in terminating immune responses.

The results presented here indicate that before acting as feedback inhibitors of the immune response, cationic peptides may also have a role in promoting the ability of leukocytes to combat bacterial infections. This could be done in part by up-regulating the chemokines IL-8 and MCP-1 and possibly also by up-regulating the surface expression of chemokine receptors such as IL-8RB, CXCR-4, and CCR2. The function of LL-37 could depend on the concentration of the peptide. For instance, at low peptide concentrations (i.e., 2 µg/ml LL-37; Ref. 42) found in normal human epithelia, LL-37 could function as an immune watchdog and, at high concentrations found when LL-37 is induced by bacteria or bacterial products, LL-37 could function to promote migration of immune cells to help control the infection. This feature appears to involve the regulation of a large number of genes, some of which are known to have anti-inflammatory and some proinflammatory roles. Importantly, we have discovered from our studies the novel finding that LL-37 induces chemokine production and surface expression of chemokine receptors and appears to do this when instilled into the lungs of mice. Thus, LL-37 may act indirectly to promote the migration of immune cells, and this may be partially responsible for its ability to protect against infection.


    Acknowledgments
 
We thank Carrie M. Rosenberger for providing several primers for RT-PCR.


    Footnotes
 
1 This study was funded by grants from the Canadian Bacterial Diseases Network (to R.E.W.H.), the Canadian Institutes of Health Research of Canada (to M.R.G. and R.E.W.H.), and the Canadian Cystic Fibrosis Foundation’s SPARx Program (to R.E.W.H.). M.G.S. was supported by a studentship from the Canadian Institutes of Health Research. R.E.W.H. is the recipient of a Canada Research Chair in Microbiology. D.J.D. is the recipient of a Wellcome Trust International Prize Traveling Research Fellowship. Back

2 Address correspondence and reprint requests to Dr. Robert E. W. Hancock, Department of Microbiology and Immunology, University of British Columbia, 6174 University Boulevard, Vancouver, British Columbia, Canada V6T 1Z3. E-mail address: bob{at}cmdr.ubc.ca Back

3 Abbreviations used in this paper: LTA, lipoteichoic acid; AraLAM, lipoarabinomannan; MCP, monocyte chemoattractant protein; BAL, bronchoalveolar lavage; LBP, LPS-binding protein; BMP, bone morphogenetic protein; MIP, macrophage-inflammatory protein. Back

Received for publication July 24, 2002. Accepted for publication July 24, 2002.


    References
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 

  1. Hancock, R. E. W., M. G. Scott. 2000. The role of antimicrobial peptides in animal defenses. Proc. Natl. Acad. Sci. USA 97:8856.[Abstract/Free Full Text]
  2. Andreu, D., L. Rivas. 1998. Animal antimicrobial peptides: an overview. Biopolymers 47:415.[Medline]
  3. Hirata, M., J. Zhong, S. C. Wright, J. W. Larrick. 1995. Structure and functions of endotoxin-binding peptides derived from CAP18. Prog. Clin. Biol. Res. 392:317.[Medline]
  4. Levy, O., C. E. Ooi, P. Elsbach, M. E. Doerfler, R. I. Lehrer, J. Weiss. 1995. Antibacterial proteins of granulocytes differ in interaction with endotoxin: comparison of bactericidal/permeability-increasing protein, p15s, and defensins. J. Immunol. 154:5403.[Abstract]
  5. Piers, K.L., M. H. Brown, R. E. W. Hancock. 1994. Improvement of outer membrane-permeabilizing and lipopolysaccharide-binding activities of an antimicrobial cationic peptide by C-terminal modification. Antimicrob. Agents Chemother. 38:2311.[Abstract/Free Full Text]
  6. Ooi, C. E., J. Weiss, M. E. Doerfler, P. Elsbach. 1991. Endotoxin-neutralizing properties of the 25 kD N-terminal fragment and a newly isolated 30 kD C-terminal fragment of the 55–60 kD bactericidal/permeability-increasing protein of human neutrophilsx. J. Exp. Med. 174:649.[Abstract/Free Full Text]
  7. Dankesreiter, S., A. Hoess, J. Schneider-Mergener, H. Wagner, T. Miethke. 2000. Synthetic endotoxin-binding peptides block endotoxin-triggered TNF-{alpha} production by macrophages in vitro and in vivo and prevent endotoxin-mediated toxic shock. J. Immunol. 164:4804.[Abstract/Free Full Text]
  8. Gough, M., R. E. W. Hancock, N. M. Kelly. 1996. Antiendotoxin activity of cationic peptide antimicrobial agents. Infect. Immun. 64:4922.[Abstract]
  9. Zhang, G. H., D. M. Mann, C. M. Tsai. 1999. Neutralization of endotoxin in vitro and in vivo by a human lactoferrin-derived peptide. Infect. Immun. 67:1353.[Abstract/Free Full Text]
  10. Hancock, R. E.W., R. Lehrer. 1998. Cationic peptides: a new source of antibiotics. Trends Biotechnol. 16:82.[Medline]
  11. Hetru, C., D. Hoffmann, P. Bulet. 1998. Antimicrobial peptides from insects. P. T. Brey, and D. Hultmark, eds. Molecular Mechanisms of Immune Responses in Insects 40.-66. Chapman & Hall, London.
  12. Lemaitre, B., E. Nicolas, L. Michaut, J. M. Reichhart, J. A. Hoffmann. 1996. The dorsoventral regulatory gene cassette spatzle/Toll/cactus controls the potent antifungal response in Drosophila adults. Cell 86:973.[Medline]
  13. Wilson, C. L., A. J. Ouellette, D. P. Satchell, T. Ayabe, Y. S. Lopez-Boado, J. L. Stratman, S. J. Hultgren, L. M. Matrisian, W. C. Parks. 1999. Regulation of intestinal {alpha}-defensin activation by the metalloproteinase matrilysin in innate host defense. Science 286:113.[Abstract/Free Full Text]
  14. Ganz, T., R. I. Lehrer. 1995. Defensins. Pharmacol. Ther. 66:19.
  15. Panyutich, A.V., E. A. Panyutich, V. A. Krapivin, E. A. Baturevich, T. Ganz. 1993. Plasma defensin concentrations are elevated in patients with septicemia or bacterial meningitis. J. Lab. Clin. Med. 122:202.[Medline]
  16. Shiomi, K., M. Nakazato, T. Ihi, K. Kangawa, H. Matsuo, S. Matsukura. 1993. Establishment of radioimmunoassay for human neutrophil peptides and their increases in plasma and neutrophil in infection. Biochim. Biophys. Acta 195:1336.
  17. Soong, L. B., T. Ganz, A. Ellison, G. H. Caughey. 1997. Purification and characterization of defensins from cystic fibrosis sputum. Inflamm. Res. 46:98.[Medline]
  18. Sorensen, O., K. Arnljots, J. B. Cowland, D. F. Bainton, N. Borregaard. 1997. The human antibacterial cathelicidin, hCAP-18, is synthesized in myelocytes and metamyelocytes and localized to specific granules in neutrophils. Blood 90:2796.[Abstract/Free Full Text]
  19. Agerberth, B., J. Charo, J. Werr, B. Olsson, F. Idali, L. Lindbom, R. Kiessling, H. Jornvall, H. Wigzell, G. H. Gudmundsson. 2000. The human antimicrobial and chemotactic peptides LL-37 and {alpha}-defensins are expressed by specific lymphocyte and monocyte populations. Blood 96:3086.[Abstract/Free Full Text]
  20. Agerberth, B., H. Gunne, J. Odeberg, P. Kogner, H. G. Boman, G. H. Gudmundsson. 1995. FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis. Proc. Natl. Acad. Sci. USA 92:195.[Abstract/Free Full Text]
  21. Frohm, M., B. Agerberth, G. Ahangari, M. Stahle-Backdahl, S. Liden, H. Wigzell, G. H. Gudmundsson. 1997. The expression of the gene coding for the antibacterial peptide LL-37 is induced in human keratinocytes during inflammatory disorders. J. Biol. Chem. 272:15258.[Abstract/Free Full Text]
  22. Bals, R., X. Wang, M. Zasloff, J. M. Wilson. 1998. The peptide antibiotic LL-37/hCAP-18 is expressed in epithelia of the human lung where it has broad antimicrobial activity at the airway surface. Proc. Natl. Acad. Sci. USA 95:9541.[Abstract/Free Full Text]
  23. Ganz, T., R. I. Lehrer. 1998. Antimicrobial peptides of vertebrates. Curr. Opin. Immunol. 10:41.[Medline]
  24. Zanetti, M., R. Gennaro, D. Romeo. 1995. Cathelicidins: a novel protein family with a common proregion and a variable C-terminal antimicrobial domain. FEBS Lett. 374:1.[Medline]
  25. Sorensen, O. E., P. Follin, A. H. Johnsen, J. Calafat, G. S. Tjabringa, P. S. Hiemstra, N. Borregaard. 2001. Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3. Blood 97:3951.[Abstract/Free Full Text]
  26. Bals, R., D. J. Weiner, A. D. Moscioni, R. L. Meegalla, J. M. Wilson. 1999. Augmentation of innate host defense by expression of a cathelicidin antimicrobial peptide. Infect. Immun. 67:6084.[Abstract/Free Full Text]
  27. Chertov, O., D. F. Michiel, L. Xu, J. M. Wang, K. Tani, W. J. Murphy, D. L. Longo, D. D. Taub, J. J. Oppenheim. 1996. Identification of defensin-1, defensin-2, and CAP37/azurocidin as T-cell chemoattractant proteins released from interleukin-8-stimulated neutrophils. J. Biol. Chem. 271:2935.[Abstract/Free Full Text]
  28. Territo, M. C., T. Ganz, M. E. Selsted, R. Lehrer. 1989. Monocyte-chemotactic activity of defensins from human neutrophils. J. Clin. Invest. 84:2017.
  29. Yang, D., O. Chertov, S. N. Bykovskaia, Q. Chen, M. J. Buffo, J. Shogan, M. Anderson, J. M. Schroder, J. M. Wang, O. M. Howard, J. J. Oppenheim. 1999. {beta}-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6. Science 286:525.[Abstract/Free Full Text]
  30. Huang, H.J., C. R. Ross, F. Blecha. 1997. Chemoattractant properties of PR-39, a neutrophil antibacterial peptide. J. Leukocyte Biol. 61:624.[Abstract]
  31. Ayabe, T., D. P. Satchell, C. L. Wilson, W. C. Parks, M. E. Selsted, A. J. Ouellette. 2000. Secretion of microbicidal {alpha}-defensins by intestinal Paneth cells in response to bacteria. Nat. Immunol. 1:113.[Medline]
  32. Gudmundsson, G. H., B. Agerberth. 1999. Neutrophil antibacterial peptides, multifunctional effector molecules in the mammalian immune system. J. Immunol. Methods 232:45.[Medline]
  33. Niyonsaba, F., K. Iwabuchi, A. Someya, M. Hirata, H. Matsuda, H. Ogawa, I. Nagaoka. 2002. A cathelicidin family of human antibacterial peptide LL-37 induces mast cell chemotaxis. Immunology 106:20.[Medline]
  34. Scott, M. G., M. R. Gold, R. E. W. Hancock. 1999. Interaction of cationic peptides with lipoteichoic acid and Gram-positive bacteria. Infect. Immun. 67:6445.[Abstract/Free Full Text]
  35. Celada, A., P. W. Gray, E. Rinderknecht, R. D. Schreiber. 1984. Evidence for a {gamma}-interferon receptor that regulates macrophage tumoricidal activity. J. Exp. Med. 160:55.[Abstract/Free Full Text]
  36. Scott, M. G., M. Rosenberger, M. R. Gold, R. E. W. Hancock. 2000. An {alpha}-helical cationic antimicrobial peptides selectively modulates macrophage responses to LPS and directly alters macrophage gene expression. J. Immunol. 165:3358.[Abstract/Free Full Text]
  37. Ho, W., A. Furst. 1973. , Intratracheal instillation method for mouse lungs. Oncology 27:385.[Medline]
  38. Valente, A. J., D. T. Graves, C. E. Vialle-Valentin, R. Delgado, C. J. Schwartz. 1988. Purification of a monocyte chemotactic factor secreted by nonhuman primate vascular cells in culture. Biochemistry 27:4162.[Medline]
  39. Allavena, P., G. Bianchi, D. Zhou, J. van Damme, P. Jilek, S. Sozzani, A. Mantovani. 1994. Induction of natural killer cell migration by monocyte chemotactic protein-1, -2 and -3. Eur. J. Immunol. 24:3233.[Medline]
  40. Carr, M. W., S. J. Roth, E. Luther, S. S. Rose, T. A. Springer. 1994. Monocyte chemoattractant protein 1 acts as a T-lymphocyte chemoattractant. Proc. Natl. Acad. Sci. USA 91:3652.[Abstract/Free Full Text]
  41. Scott, M. G., A. C. Vreugdenhil, W. A. Buurman, R. E. W. Hancock, M. R. Gold. 2000. Cutting edge: cationic antimicrobial peptides block the binding of lipopolysaccharide (LPS) to LPS binding protein. J. Immunol. 164:549.[Abstract/Free Full Text]
  42. Bals, R., D. J. Weiner, R. L. Meegalla, J. M. Wilson. 1999. Transfer of a cathelicidin peptide antibiotic gene restores bacterial killing in a cystic fibrosis xenograft model. J. Clin. Invest. 103:1113.[Medline]



This article has been cited by other articles:


Home page
J. Immunol.Home page
G. Bergsson, E. P. Reeves, P. McNally, S. H. Chotirmall, C. M. Greene, P. Greally, P. Murphy, S. J. O'Neill, and N. G. McElvaney
LL-37 Complexation with Glycosaminoglycans in Cystic Fibrosis Lungs Inhibits Antimicrobial Activity, Which Can Be Restored by Hypertonic Saline
J. Immunol., July 1, 2009; 183(1): 543 - 551.
[Abstract] [Full Text] [PDF]


Home page
J. Bacteriol.Home page
A. Jones, M. Georg, L. Maudsdotter, and A.-B. Jonsson
Endotoxin, Capsule, and Bacterial Attachment Contribute to Neisseria meningitidis Resistance to the Human Antimicrobial Peptide LL-37
J. Bacteriol., June 15, 2009; 191(12): 3861 - 3868.
[Abstract] [Full Text] [PDF]


Home page
Antimicrob. Agents Chemother.Home page
Y. Okuyama-Nishida, N. Akiyama, G. Sugimori, K. Nomura, K. Ogawa, K. J. Homma, K. Sekimizu, M. Tsujimoto, and S. Natori
Prevention of Death in Bacterium-Infected Mice by a Synthetic Antimicrobial Peptide, L5, through Activation of Host Immunity
Antimicrob. Agents Chemother., June 1, 2009; 53(6): 2510 - 2516.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
C.-S. Yang, D.-M. Shin, K.-H. Kim, Z.-W. Lee, C.-H. Lee, S. G. Park, Y. S. Bae, and E.-K. Jo
NADPH Oxidase 2 Interaction with TLR2 Is Required for Efficient Innate Immune Responses to Mycobacteria via Cathelicidin Expression
J. Immunol., March 15, 2009; 182(6): 3696 - 3705.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
S. Hansdottir, M. M. Monick, S. L. Hinde, N. Lovan, D. C. Look, and G. W. Hunninghake
Respiratory Epithelial Cells Convert Inactive Vitamin D to Its Active Form: Potential Effects on Host Defense
J. Immunol., November 15, 2008; 181(10): 7090 - 7099.
[Abstract] [Full Text] [PDF]


Home page
J DAIRY SCIHome page
J. L. Boehmer, D. D. Bannerman, K. Shefcheck, and J. L. Ward
Proteomic Analysis of Differentially Expressed Proteins in Bovine Milk During Experimentally Induced Escherichia coli Mastitis
J Dairy Sci, November 1, 2008; 91(11): 4206 - 4218.
[Abstract] [Full Text] [PDF]


Home page
JDRHome page
G. Diamond, N. Beckloff, and L.K. Ryan
Host Defense Peptides in the Oral Cavity and the Lung: Similarities and Differences
Journal of Dental Research, October 1, 2008; 87(10): 915 - 927.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
R. Bucki, F. J. Byfield, A. Kulakowska, M. E. McCormick, W. Drozdowski, Z. Namiot, T. Hartung, and P. A. Janmey
Extracellular Gelsolin Binds Lipoteichoic Acid and Modulates Cellular Response to Proinflammatory Bacterial Wall Components
J. Immunol., October 1, 2008; 181(7): 4936 - 4944.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
H. Y. Lee, S. D. Kim, J. W. Shim, S. Y. Lee, H. Lee, K.-H. Cho, J. Yun, and Y.-S. Bae
Serum Amyloid A Induces CCL2 Production via Formyl Peptide Receptor-Like 1-Mediated Signaling in Human Monocytes
J. Immunol., September 15, 2008; 181(6): 4332 - 4339.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
Z. Zhang, G. Cherryholmes, and J. E. Shively
Neutrophil secondary necrosis is induced by LL-37 derived from cathelicidin
J. Leukoc. Biol., September 1, 2008; 84(3): 780 - 788.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
M. L. Mangoni, R. F. Epand, Y. Rosenfeld, A. Peleg, D. Barra, R. M. Epand, and Y. Shai
Lipopolysaccharide, a Key Molecule Involved in the Synergism between Temporins in Inhibiting Bacterial Growth and in Endotoxin Neutralization
J. Biol. Chem., August 22, 2008; 283(34): 22907 - 22917.
[Abstract] [Full Text] [PDF]


Home page
Infect. Immun.Home page
B. Rivas-Santiago, R. Hernandez-Pando, C. Carranza, E. Juarez, J. L. Contreras, D. Aguilar-Leon, M. Torres, and E. Sada
Expression of Cathelicidin LL-37 during Mycobacterium tuberculosis Infection in Human Alveolar Macrophages, Monocytes, Neutrophils, and Epithelial Cells
Infect. Immun., March 1, 2008; 76(3): 935 - 941.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
J. Yu, N. Mookherjee, K. Wee, D. M. E. Bowdish, J. Pistolic, Y. Li, L. Rehaume, and R. E. W. Hancock
Host Defense Peptide LL-37, in Synergy with Inflammatory Mediator IL-1beta, Augments Immune Responses by Multiple Pathways
J. Immunol., December 1, 2007; 179(11): 7684 - 7691.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
A. R. Martineau, K. A. Wilkinson, S. M. Newton, R. A. Floto, A. W. Norman, K. Skolimowska, R. N. Davidson, O. E. Sorensen, B. Kampmann, C. J. Griffiths, et al.
IFN-{gamma}- and TNF-Independent Vitamin D-Inducible Human Suppression of Mycobacteria: The Role of Cathelicidin LL-37
J. Immunol., June 1, 2007; 178(11): 7190 - 7198.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
N. Mookherjee, H. L. Wilson, S. Doria, Y. Popowych, R. Falsafi, J. Yu, Y. Li, S. Veatch, F. M. Roche, K. L. Brown, et al.
Bovine and human cathelicidin cationic host defense peptides similarly suppress transcriptional responses to bacterial lipopolysaccharide
J. Leukoc. Biol., December 1, 2006; 80(6): 1563 - 1574.
[Abstract] [Full Text] [PDF]


Home page
J. Am. Soc. Nephrol.Home page
M. Ding, S. Cui, C. Li, S. Jothy, V. Haase, B. Steer, P. Marsden, J. Pippin, S. Shankland, M. Rastaldi, et al.
Faulty Podocyte Hypoxia Sensing--A Novel Pathway for Rapidly Progressive Glomerulonephritis: Loss of the Tumor Suppressor Vhlh Leads to Upregulation of Cxcr4 and Rapidly Progressive Glomerulonephritis. Nat Med 12: 1081-1087, 2006
J. Am. Soc. Nephrol., December 1, 2006; 17(12): 3267 - 3272.
[Full Text] [PDF]


Home page
Int ImmunolHome page
K. Kandler, R. Shaykhiev, P. Kleemann, F. Klescz, M. Lohoff, C. Vogelmeier, and R. Bals
The anti-microbial peptide LL-37 inhibits the activation of dendritic cells by TLR ligands
Int. Immunol., December 1, 2006; 18(12): 1729 - 1736.
[Abstract] [Full Text] [PDF]


Home page
J. Am. Soc. Nephrol.Home page
P.T. Liu, S. Stenger, H. Li, L. Wenzel, B.H. Tan, S.R. Krutzik, M.T. Ochoa, J. Schauber, K. Wu, C. Meinken, et al.
Vitamin D3-Triggered Antimicrobial Response--Another Pleiotropic Effect beyond Mineral and Bone Metabolism: Toll-Like Receptor Triggering of a Vitamin D-Mediated Human Antimicrobial Response. Science 311: 1770-1773, 2006
J. Am. Soc. Nephrol., November 1, 2006; 17(11): 2949 - 2953.
[Full Text] [PDF]


Home page
J. Immunol.Home page
S. Dudal, C. Turriere, S. Bessoles, P. Fontes, F. Sanchez, J. Liautard, J.-P. Liautard, and V. Lafont
Release of LL-37 by Activated Human V{gamma}9V{delta}2 T Cells: A Microbicidal Weapon against Brucella suis
J. Immunol., October 15, 2006; 177(8): 5533 - 5539.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
P. G. Barlow, Y. Li, T. S. Wilkinson, D. M. E. Bowdish, Y. E. Lau, C. Cosseau, C. Haslett, A. J. Simpson, R. E. W. Hancock, and D. J. Davidson
The human cationic host defense peptide LL-37 mediates contrasting effects on apoptotic pathways in different primary cells of the innate immune system
J. Leukoc. Biol., September 1, 2006; 80(3): 509 - 520.
[Abstract] [Full Text] [PDF]


Home page
J. Pharmacol. Exp. Ther.Home page
Y. H. Yang, W. K. K. Wu, E. K. K. Tai, H. P. S. Wong, E. K. Y. Lam, W. H. L. So, V. Y. Shin, and C. H. Cho
The Cationic Host Defense Peptide rCRAMP Promotes Gastric Ulcer Healing in Rats
J. Pharmacol. Exp. Ther., August 1, 2006; 318(2): 547 - 554.
[Abstract] [Full Text] [PDF]


Home page
Clin. Microbiol. Rev.Home page
H. Jenssen, P. Hamill, and R. E. W. Hancock
Peptide Antimicrobial Agents
Clin. Microbiol. Rev., July 1, 2006; 19(3): 491 - 511.
[Abstract] [Full Text] [PDF]


Home page
Antimicrob. Agents Chemother.Home page
J. E. Thwaite, S. Hibbs, R. W. Titball, and T. P. Atkins
Proteolytic Degradation of Human Antimicrobial Peptide LL-37 by Bacillus anthracis May Contribute to Virulence.
Antimicrob. Agents Chemother., July 1, 2006; 50(7): 2316 - 2322.
[Abstract] [Full Text] [PDF]


Home page
Arterioscler. Thromb. Vasc. Bio.Home page
K. Edfeldt, B. Agerberth, M. E. Rottenberg, G. H. Gudmundsson, X.-B. Wang, K. Mandal, Q. Xu, and Z.-q. Yan
Involvement of the Antimicrobial Peptide LL-37 in Human Atherosclerosis
Arterioscler. Thromb. Vasc. Biol., July 1, 2006; 26(7): 1551 - 1557.
[Abstract] [Full Text] [PDF]


Home page
JEMHome page
A. Macagno, M. Molteni, A. Rinaldi, F. Bertoni, A. Lanzavecchia, C. Rossetti, and F. Sallusto
A cyanobacterial LPS antagonist prevents endotoxin shock and blocks sustained TLR4 stimulation required for cytokine expression
J. Exp. Med., June 12, 2006; 203(6): 1481 - 1492.
[Abstract] [Full Text] [PDF]


Home page
IOVSHome page
L. C. Huang, T. D. Petkova, R. Y. Reins, R. J. Proske, and A. M. McDermott
Multifunctional Roles of Human Cathelicidin (LL-37) at the Ocular Surface.
Invest. Ophthalmol. Vis. Sci., June 1, 2006; 47(6): 2369 - 2380.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Respir. Cell Mol. Bio.Home page
Y. E. Lau, D. M. E. Bowdish, C. Cosseau, R. E. W. Hancock, and D. J. Davidson
Apoptosis of Airway Epithelial Cells: Human Serum Sensitive Induction by the Cathelicidin LL-37
Am. J. Respir. Cell Mol. Biol., April 1, 2006; 34(4): 399 - 409.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
N. Mookherjee, K. L. Brown, D. M. E. Bowdish, S. Doria, R. Falsafi, K. Hokamp, F. M. Roche, R. Mu, G. H. Doho, J. Pistolic, et al.
Modulation of the TLR-Mediated Inflammatory Response by the Endogenous Human Host Defense Peptide LL-37
J. Immunol., February 15, 2006; 176(4): 2455 - 2464.
[Abstract] [Full Text] [PDF]


Home page
ChestHome page
W. Xiao, Y.-P. Hsu, A. Ishizaka, T. Kirikae, and R. B. Moss
Sputum Cathelicidin, Urokinase Plasminogen Activation System Components, and Cytokines Discriminate Cystic Fibrosis, COPD, and Asthma Inflammation
Chest, October 1, 2005; 128(4): 2316 - 2326.
[Abstract] [Full Text] [PDF]


Home page
Antimicrob. Agents Chemother.Home page
B. Deslouches, K. Islam, J. K. Craigo, S. M. Paranjape, R. C. Montelaro, and T. A. Mietzner
Activity of the De Novo Engineered Antimicrobial Peptide WLBU2 against Pseudomonas aeruginosa in Human Serum and Whole Blood: Implications for Systemic Applications
Antimicrob. Agents Chemother., August 1, 2005; 49(8): 3208 - 3216.
[Abstract] [Full Text] [PDF]


Home page
Innate ImmunityHome page
D. M.E. Bowdish and R. E.W. Hancock
Anti-endotoxin properties of cationic host defence peptides and proteins
Innate Immunity, August 1, 2005; 11(4): 230 - 236.
[Abstract] [PDF]


Home page
Antimicrob. Agents Chemother.Home page
C. D. Ciornei, T. Sigurdardottir, A. Schmidtchen, and M. Bodelsson
Antimicrobial and Chemoattractant Activity, Lipopolysaccharide Neutralization, Cytotoxicity, and Inhibition by Serum of Analogs of Human Cathelicidin LL-37
Antimicrob. Agents Chemother., July 1, 2005; 49(7): 2845 - 2850.
[Abstract] [Full Text] [PDF]


Home page
FASEB J.Home page
A. F. Gombart, N. Borregaard, and H. P. Koeffler
Human cathelicidin antimicrobial peptide (CAMP) gene is a direct target of the vitamin D receptor and is strongly up-regulated in myeloid cells by 1,25-dihydroxyvitamin D3
FASEB J, July 1, 2005; 19(9): 1067 - 1077.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
K. Kurosaka, Q. Chen, F. Yarovinsky, J. J. Oppenheim, and D. Yang
Mouse Cathelin-Related Antimicrobial Peptide Chemoattracts Leukocytes Using Formyl Peptide Receptor-Like 1/Mouse Formyl Peptide Receptor-Like 2 as the Receptor and Acts as an Immune Adjuvant
J. Immunol., May 15, 2005; 174(10): 6257 - 6265.
[Abstract] [Full Text] [PDF]


Home page
Antimicrob. Agents Chemother.Home page
D. M. E. Bowdish, D. J. Davidson, M. G. Scott, and R. E. W. Hancock
Immunomodulatory Activities of Small Host Defense Peptides
Antimicrob. Agents Chemother., May 1, 2005; 49(5): 1727 - 1732.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
J. Oliaro, S. Dudal, J. Liautard, J.-B. Andrault, J.-P. Liautard, and V. Lafont
V{gamma}9V{delta}2 T cells use a combination of mechanisms to limit the spread of the pathogenic bacteria Brucella
J. Leukoc. Biol., May 1, 2005; 77(5): 652 - 660.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
M. Iimura, R. L. Gallo, K. Hase, Y. Miyamoto, L. Eckmann, and M. F. Kagnoff
Cathelicidin Mediates Innate Intestinal Defense against Colonization with Epithelial Adherent Bacterial Pathogens
J. Immunol., April 15, 2005; 174(8): 4901 - 4907.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
D. M. E. Bowdish, D. J. Davidson, Y. E. Lau, K. Lee, M. G. Scott, and R. E. W. Hancock
Impact of LL-37 on anti-infective immunity
J. Leukoc. Biol., April 1, 2005; 77(4): 451 - 459.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
N. Borregaard, K. Theilgaard-Monch, J. B. Cowland, M. Stahle, and O. E. Sorensen
Neutrophils and keratinocytes in innate immunity--cooperative actions to provide antimicrobial defense at the right time and place
J. Leukoc. Biol., April 1, 2005; 77(4): 439 - 443.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
S. van Wetering, G. S. Tjabringa, and P. S. Hiemstra
Interactions between neutrophil-derived antimicrobial peptides and airway epithelial cells
J. Leukoc. Biol., April 1, 2005; 77(4): 444 - 450.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
M. H. Braff, M. A. Hawkins, A. D. Nardo, B. Lopez-Garcia, M. D. Howell, C. Wong, K. Lin, J. E. Streib, R. Dorschner, D. Y. M. Leung, et al.
Structure-Function Relationships among Human Cathelicidin Peptides: Dissociation of Antimicrobial Properties from Host Immunostimulatory Activities
J. Immunol., April 1, 2005; 174(7): 4271 - 4278.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
T. D. Starner, B. Agerberth, G. H. Gudmundsson, and P. B. McCray Jr.
Expression and Activity of {beta}-Defensins and LL-37 in the Developing Human Lung
J. Immunol., February 1, 2005; 174(3): 1608 - 1615.
[Abstract] [Full Text] [PDF]


Home page
Infect. Immun.Home page
Y. E. Lau, A. Rozek, M. G. Scott, D. L. Goosney, D. J. Davidson, and R. E. W. Hancock
Interaction and Cellular Localization of the Human Host Defense Peptide LL-37 with Lung Epithelial Cells
Infect. Immun., January 1, 2005; 73(1): 583 - 591.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
D. Yang, Q. Chen, H. F. Rosenberg, S. M. Rybak, D. L. Newton, Z. Y. Wang, Q. Fu, V. T. Tchernev, M. Wang, B. Schweitzer, et al.
Human Ribonuclease A Superfamily Members, Eosinophil-Derived Neurotoxin and Pancreatic Ribonuclease, Induce Dendritic Cell Maturation and Activation
J. Immunol., November 15, 2004; 173(10): 6134 - 6142.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
O. Levy
Antimicrobial proteins and peptides: anti-infective molecules of mammalian leukocytes
J. Leukoc. Biol., November 1, 2004; 76(5): 909 - 925.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
T.-T. Wang, F. P. Nestel, V. Bourdeau, Y. Nagai, Q. Wang, J. Liao, L. Tavera-Mendoza, R. Lin, J. H. Hanrahan, S. Mader, et al.
Cutting Edge: 1,25-Dihydroxyvitamin D3 Is a Direct Inducer of Antimicrobial Peptide Gene Expression
J. Immunol., September 1, 2004; 173(5): 2909 - 2912.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
D. M. E. Bowdish, D. J. Davidson, D. P. Speert, and R. E. W. Hancock
The Human Cationic Peptide LL-37 Induces Activation of the Extracellular Signal-Regulated Kinase and p38 Kinase Pathways in Primary Human Monocytes
J. Immunol., March 15, 2004; 172(6): 3758 - 3765.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Respir. Crit. Care Med.Home page
D. M. Shasby and P. McCray
Sepsis and Innate Immunity
Am. J. Respir. Crit. Care Med., January 15, 2004; 169(2): 144 - 145.
[Full Text] [PDF]


Home page
J. Immunol.Home page
D. J. Davidson, A. J. Currie, G. S. D. Reid, D. M. E. Bowdish, K. L. MacDonald, R. C. Ma, R. E. W. Hancock, and D. P. Speert
The Cationic Antimicrobial Peptide LL-37 Modulates Dendritic Cell Differentiation and Dendritic Cell-Induced T Cell Polarization
J. Immunol., January 15, 2004; 172(2): 1146 - 1156.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
M. Zanetti
Cathelicidins, multifunctional peptides of the innate immunity
J. Leukoc. Biol., January 1, 2004; 75(1): 39 - 48.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
G. S. Tjabringa, J. Aarbiou, D. K. Ninaber, J. W. Drijfhout, O. E. Sorensen, N. Borregaard, K. F. Rabe, and P. S. Hiemstra
The Antimicrobial Peptide LL-37 Activates Innate Immunity at the Airway Epithelial Surface by Transactivation of the Epidermal Growth Factor Receptor
J. Immunol., December 15, 2003; 171(12): 6690 - 6696.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
A. Di Nardo, A. Vitiello, and R. L. Gallo
Cutting Edge: Mast Cell Antimicrobial Activity Is Mediated by Expression of Cathelicidin Antimicrobial Peptide
J. Immunol., March 1, 2003; 170(5): 2274 - 2278.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow Request Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Scott, M. G.
Right arrow Articles by Hancock, R. E. W.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Scott, M. G.
Right arrow Articles by Hancock, R. E. W.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS