The JI
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     
 


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow Request Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Zwaveling, S.
Right arrow Articles by Melief, C. J. M.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Zwaveling, S.
Right arrow Articles by Melief, C. J. M.
The Journal of Immunology, 2002, 169: 350-358.
Copyright © 2002 by The American Association of Immunologists

Established Human Papillomavirus Type 16-Expressing Tumors Are Effectively Eradicated Following Vaccination with Long Peptides1

Sander Zwaveling*,{dagger}, Sandra C. Ferreira Mota*, Jan Nouta*, Mark Johnson{ddagger}, Grayson B. Lipford§, Rienk Offringa*, Sjoerd H. van der Burg2,* and Cornelis J. M. Melief2,3,*

Departments of * Immunohematology and Blood Transfusion and {dagger} Surgery, Leiden University Medical Center, Leiden, The Netherlands; {ddagger} Corixa Corp., Seattle, WA 92104; and § Coley Pharmaceutical, Langenfeld, Germany


    Abstract
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Peptide-based vaccines aimed at the induction of effective T cell responses against established cancers have so far only met with limited clinical success and clearly need to be improved. In a preclinical model of human papillomavirus (HPV)16-induced cervical cancer we show that prime-boost vaccinations with the HPV16-derived 35 amino-acid long peptide E743–77, containing both a CTL epitope and a Th epitope, resulted in the induction of far more robust E7-specific CD8+ T cell responses than vaccinations with the minimal CTL epitope only. We demonstrate that two distinct mechanisms are responsible for this effect. First, vaccinations with the long peptide lead to the generation of E7-specific CD4+ Th cells. The level of the induced E7-specific CD8+ T cell response proved to be dependent on the interactions of these Th cells with professional APC. Second, we demonstrate that vaccination with the long peptide and dendritic cell-activating agents resulted in a superior induction of E7-specific CD8+ T cells, even when T cell help was excluded. This suggests that, due to its size, the long peptide was preferably endocytosed, processed, and presented by professional APCs. Moreover, the efficacy of this superior HPV-specific T cell induction was demonstrated in therapeutic prime-boost vaccinations in which the long peptide admixed with the dendritic cell-activating adjuvant oligodeoxynucleotide-CpG resulted in the eradication of large, established HPV16-expressing tumors. Because the vaccine types used in this study are easy to prepare under good manufacturing practice conditions and are safe to administer to humans, these data provide important information for future clinical trials.


    Introduction
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Oncogenic, so-called high-risk types of human papillomavirus (HPV),4 such as HPV16, are the main causative factor in the pathogenesis of cervical carcinomas (1). The majority of these cancers expresses the HPV16-derived E6 and E7 oncoproteins (2), which are therefore attractive targets for T cell-mediated immunotherapy (3). Several observations, such as the spontaneous regression of most premalignant cervical lesions (4, 5, 6) and the infiltration of CD4+ T cells and macrophages in regressing genital warts (7, 8), suggest that therapeutic vaccination may prevent progression from oncogenic HPV infection through cervical intraepithelial neoplasia to cervical cancer. This notion is supported by the fact that an increase in HPV infection was found in immunosuppressed (9) and immunodeficient (10) patients.

Over the years, various vaccines containing exactly fitting MHC class I-binding peptides have been tested for their therapeutic efficacy against both virally and nonvirally induced cancers (11, 12). However, the observed immunological and clinical responses were rather meager. Therefore, ways to develop more powerful cancer vaccines should be thoroughly explored. In a preclinical model we previously achieved considerable success when mice were vaccinated with a H-2Db-restricted HPV16 E7 CTL epitope (E749–57, RAHYNIVTF) emulsified in IFA (13). Immunized mice developed CTL-mediated protection against a subsequent challenge with an otherwise lethal dose of HPV16 E7-expressing tumor cells. Based on these encouraging findings several HPV peptide-based vaccines comprising minimal CTL epitopes were tested in patients with progressive disease (12, 14, 15). Although moderate T cell responses were observed, the clinical benefit was only modest. This may be due to an impaired immune system, which is commonly found in patients diagnosed with cancer, but failure of the vaccines to induce strong sustained immunity is more likely to be the cause. Recent preclinical data demonstrated that tumor-specific CD4+ Th cells critically contribute to the development and efficacy of antitumor responses (16, 17, 18, 19, 20). The effectiveness of these Th cells probably lies in their capacity to deliver essential activation signals to professional APCs, such as dendritic cells (DC), needed for an optimal priming of tumor-specific CTL (21, 22, 23, 24). In addition, Ag-specific CD4+ T cells may provide CTL with essential growth stimuli during the effector phase (25). In line with this notion, several studies show that effective CTL priming can be induced by the inclusion of Th epitopes in peptide vaccines (26, 27, 28, 29). Another strategy to power up vaccines is the use of molecularly defined strong DC-activating adjuvants such as oligodeoxynucleotide (ODN)-CpG (30, 31, 32), monophosphoryl lipid A (MPL) (33, 34), anti-CD40 Ab (35), and GM-CSF (36).

We have recently developed a clinical grade vaccine against HPV16 that consists of 32- to 35-aa-long overlapping peptides, together covering the HPV16 E6 and E7 protein sequences. The design of these long peptides was based on the presence of Th and CTL epitopes (3, 37, 38, 39), but we also speculated that, due to the length of the peptides, direct binding to MHC class I molecules would not take place. As a consequence, endocytosis, processing, and presentation by professional APC would be required to induce HPV16-specific CTL, and this would circumvent the potential hazard of peptide-induced tolerance (40).

In a preclinical mouse tumor model we analyzed the T cell response to one of these 35-aa-long peptides, containing both a HPV16 E7-derived Th epitope and the HPV16 E749–57 CTL epitope. As demonstrated earlier (26), the physical linkage between these two epitope types may potentiate specific CTL responses. Vaccination with the long peptide resulted in markedly improved CTL responses in comparison to the minimal essential CTL epitope vaccine. In-depth analysis revealed that two distinct mechanisms were responsible. Moreover, vaccination with the long peptide and the DC-activating agent ODN-CpG induced strong antitumor immunity that eradicated established tumors with sizes that otherwise resulted in the death of mice within ~5 days.


    Materials and Methods
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Mice and cell lines

C57BL/6 (B6, H-2b) mice were obtained from IFFA Credo (Paris, France). MHC class II-/- B6 mice were purchased from Taconic Farms (Germantown, NY) and CD40-/- B6 mice were obtained from The Jackson Laboratory (Bar Harbor, ME). Tumor cell line TC-1 was generated by retroviral transduction of lung fibroblasts of C57BL/6 origin by HPV16 E6/E7 and c-H-ras oncogenes (41). Tumor cell line 13.2 was derived from MEC (B6) transformed with adenovirus type 5-derived E1 protein in which the H-2Db E1A epitope was replaced with the HPV16 E749–57 CTL epitope. Isolation and culture of the HPV16 E7-specific CTL clone 9.5, the p53-specific CTL clone 1H11, and the nonrelevant 9.42 CTL clone have been described elsewhere (42, 43, 44). D1 cells are long-term growth factor-dependent immature splenic DC derived from C57BL/6 mice and were cultured as described (45, 46).

Peptides

Peptides were generated as described before (13). The purity of the peptides was determined by reverse-phase HPLC and was found to be routinely >90% pure. Peptides were dissolved in 0.5% DMSO in PBS and, if not used immediately, stored at -20°C. The nomenclature refers to the numbers of the first and last amino acid. The HPV16-derived peptide E749–57 (RAHYNIVTF) was selected because it was identified as an H-2Db CTL epitope (13). The E743–77 35-residue long peptide (GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR), which represents one of the peptides of a good manufacturing practice-grade vaccine against HPV16-induced tumors currently tested in a clinical trial, contains the E749–57 CTL epitope with its natural flanking sequences. (CTL epitope underlined). HPLC and mass spectrometry demonstrated that no small fragments representing the minimal CTL epitope were present in this peptide lot. The DRAHYNIVTF sequence, which is encompassed in this peptide, represents a Th epitope (47).

Tetramers and Abs

PE-labeled H-2Db epitope E749–57 (RAHYNIVTF)-containing tetramers were constructed and used for the analysis of peptide-specific CTL immunity as described earlier (48). FITC-labeled anti-CD8b.2 Ab (Ly-3.2; clone 53-5.8), allophycocyanin-labeled anti-CD4 Ab (L3T4; clone RM4-5), and PE-labeled anti-IFN-{gamma} Ab (clone XMG1.2) (BD PharMingen, San Diego, CA) were used in the various FACS procedures.

Adjuvants

IFA was obtained from Difco (Detroit, MI). Montanide ISA 51 was purchased from SEPPIC (Paris, France). CpG-ODN 1826, sequence TTCATGACGTTCCTGACGTT, was provided by Coley Pharmaceutical (Langenfeld, Germany) and used at a their suggested optimal working concentration of 50 µg/mouse. GM-CSF was obtained from PeproTech (Rocky Hill, NJ) and used at a concentration of 4 µg/mouse based on the work of Disis et al. (36). The FGK-45 hybridoma cells producing stimulatory anti-CD40 Ab were provided by Dr. A. Rolink (University of Basel, Basel, Switzerland). MPL was provided by Corixa (Seattle, WA) and used at the suggested optimal concentration of 10 µg/mouse.

Immunization strategies

C57BL/6 mice were injected s.c. with either 50 µg E749–57 short peptide or 150 µg E743–77 35-residue long peptide dissolved in PBS to achieve similar molar levels of the E749–57 CTL epitope in both cases. Combinations with various adjuvants were tested. In the case of IFA and Montanide, the dissolved peptides were emulsified in 50% of these respective substances. ODN-CpG, MPL, and GM-CSF were all dissolved in PBS and mixed with the peptides before s.c. vaccination. The total injected volume was 200 µl/mouse. Anti-CD40 Ab was dissolved in PBS and injected separately from the peptides i.v. on days 0, 1, and 2 at an amount of 100 µg per injection (a total volume of 200 µl/mouse) as described before (35). Spleens were harvested after 10 days. In the prime-boost experiments with IFA, mice were boosted with identical vaccines 50 days after priming to allow the formation of memory CTL and Th cells (49). In these experiments spleens were harvested 10 days after the booster immunization. In the therapeutic antitumor experiments, tumor-bearing mice were vaccinated at the time tumors were palpable in all mice and 14 days later, considering the aggressive outgrowth of TC-1 tumors in untreated mice.

T cell cultures

T cells were obtained from immunized mice by culturing spleen cells (5 x 106 cells/well of a 24-well plate) in complete medium in the presence of 0.5 x 106 E749–57-expressing cells (tumor cell line 13.2) or, when indicated, in the presence of D1 cells. Before use, the D1 cells were incubated for 16 h with the E743–77 long peptide and subsequently activated by adding LPS (10 µg/ml) for 6 h and then thoroughly washed. Complete medium consists of IMDM (BioWhittaker, Walkersville, MD) supplemented with 8% FCS, 100 IU/ml penicillin, 2 mM glutamine (ICN, Aurora, OH), and 30 µM 2-ME (Merck, Darmstadt, Germany). Cultures were maintained at 37°C in humidified air containing 5% CO2. No exogenous IL-2 was added. On day 6, dead cells were removed from the culture by centrifugation over a Ficoll density gradient and remaining cells were seeded in 24-well plates at 1 x 106 cells/well. On day 7 tetramer staining or intracellular cytokine staining was performed.

Tetramer staining

Spleen cultures, stimulated with tumor cell line 13.2 for 7 days, were transferred at 40 x 104 cells per well to 96-well V-bottom microtiter plates and washed twice with PBS/BSA 0.5%. Subsequently, PE-labeled E749–57-containing tetramer was added. After 30 min of incubation at room temperature, cells were washed twice with PBS/BSA 0.5% and incubated with FITC-labeled anti-CD8b Ab for 30 min. Subsequently cells were washed twice in PBS/BSA 0.5%, suspended in PBS/BSA 0.5% containing propidium iodide (0.5 µg/ml) and transferred to tubes. Cell samples were analyzed in a FACSCalibur flow cytometer (BD Biosciences, San Jose, CA) using CellQuest software (BD Biosciences). A total of 20 x 104 events were analyzed for fluorescence intensity. Debris was gated out using the propidium iodide staining and subsequently the CD8+ fraction was gated. Mean background tetramer staining of similarly cultured and stained cells from nonimmunized control mice was found to be <1% of CD8+ cells (0.94%; SD, 0.36%). As a positive control the HPV16 E7-specific CTL clone 9.5 was used.

Intracellular cytokine staining

Spleen cultures were stimulated with D1 cells pulsed with 35-mer E743–77 for 7 days. Subsequently, the percentage of CD8+ and CD4+ IFN-{gamma}-producing T cells was measured as described before (48). LPS-activated nonpulsed D1 cells or D1 cells pulsed with short peptide or the long peptide (5 µg/ml) were used as stimulator cells.

Cytokine ELISA

The production of IFN-{gamma} by the CTL clones 9.5, 1H11, and 9.42 was measured as described elsewhere (50).

Statistics

The survival of mice receiving various treatments was statistically analyzed using the Kaplan-Meier test. Where indicated the survival was significantly prolonged (p < 0.05).


    Results
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Prime-boost vaccinations with the HPV16 E743–77 35-aa-long Th and CTL epitope-containing peptide result in a robust CD8+ T cell response

Mice (B6) were vaccinated once with either the minimal CTL epitope HPV16 E749–57 (short peptide) or the HPV16 E743–77 35-residue long peptide, admixed with IFA. Ten days after vaccination, the spleens were harvested and subjected to an extra round of in vitro stimulation that magnifies but does not alter the hierarchy of in vivo induced CD8+ T cell responses before the percentage of E749–57 peptide-specific CD8+ T cells was determined by H2-Db E749–57 (RAHYNIVTF) tetramer staining (48). Because immunization with short peptide in IFA has been shown to induce E749–57-specific CD8+ T cells that are able to protect mice from a subsequent tumor challenge (13), but which were not demonstrable by tetramer analysis directly ex vivo, we decided to use one round of in vitro stimulation to discriminate nonresponding mice from those with low/high T cell frequencies.

In both groups, three of nine mice responded to the vaccine while generally 5% of the CD8+ T cells stained with tetramers (Fig. 1Go, A and B), suggesting that the vaccines perform equally well when injected once.



View larger version (16K):
[in this window]
[in a new window]
 
FIGURE 1. High E749–57-specific CD8+ T cell responses are detected following prime-boost vaccinations with the HPV16 long peptide. Mice (B6) were either vaccinated once with the E749–57 peptide (A) or the E743–77 long peptide (B), or primed and boosted 50 days later with the E749–57 peptide (C) or the E743–77 long peptide (D). MHC class II-/- mice (E) and CD40-/- mice (F) were primed and boosted with the E743–77 long peptide. Peptides were emulsified in IFA. Ten days following the final vaccination spleens were harvested and T cell cultures were stimulated with the E749–57-expressing tumor cell line 13.2. Subsequently, the percentage of E749–57 tetramer-positive CD8+ cells was determined by FACS analysis. Each bar represents an individual mouse. Horizontal lines indicate background responses plus SD of naive mice.

 
To induce a more vigorous E749–57-specific CD8+ T cell response, both vaccines were used in a prime-boost regimen, which allowed primed T cells to form memory T cells before the response was boosted by a second vaccination 50 days later (49). Mice vaccinated with the minimal CTL epitope showed CD8+ T cell responses of similar strength as those seen after one vaccination (Fig. 1GoC). In contrast, mice vaccinated with the long peptide displayed a more robust E749–57-specific CD8+ T cell response in 9 of 11 mice, with high numbers of E749–57-specific CD8+ T cells (mean, 19%; range, 5–40%) (Fig. 1GoD). These experiments demonstrate that vaccination with the long peptide in a homologous prime-boost regimen is superior to vaccination with the minimal CTL epitope and suggest that the formation of Th cells, by the intrinsic Th epitope present in the long peptide (47), contributes considerably to the level of the CD8+ T cell responses.

The high E749–57-specific CD8+ T cell response is dependent on MHC class II-restricted Th type 1 cells and CD40-CD40L interactions

To directly assess whether CD4+ Th cells were induced after priming, allowing the formation of memory Th cells before the second vaccination, wild-type B6 mice were vaccinated once with the long peptide in IFA. Subsequently the percentage of E743–77-specific IFN-{gamma}-producing CD4+ T cells was measured by intracellular cytokine staining. Whereas no responses over background were observed in naive mice (data not shown), 5% or more of the CD4+ T cells from vaccinated mice specifically responded upon stimulation with the long E743–77 peptide (Fig. 2GoA). To further demonstrate that the impressive CD8+ T cell responses, detected following prime-boost vaccinations with the long E743–77 peptide, were in fact enhanced by MHC class II-restricted E7-specific CD4+ Th cells, MHC class II-/- mice were prime-boosted with the long peptide vaccine. The number of E749–57-specific CD8+ T cells detected in the MHC class II-/- mice (Fig. 1GoE) was far lower than found in B6 mice after two vaccinations and comparable to that found after one vaccination with the long peptide (Fig. 1GoB). These data not only indicate that MHC class II-restricted CD4+ Th type 1 responses are induced after one vaccination but also suggest that these E743–77 peptide-specific Th cells are required for inducing vigorous CD8+ T cell responses. Most likely, professional APC that process and present the long peptide upon the booster immunization are activated through CD40-CD40 ligand (CD40L) interactions by E743–77 peptide-specific Th cells (47), and this will lead to enhanced CD8+ T cell activation.



View larger version (20K):
[in this window]
[in a new window]
 
FIGURE 2. E7-specific CD4+ Th type 1 cells are induced following priming with the E743–77 long peptide. Mice (B6) were vaccinated s.c. with the long peptide admixed with IFA (A) or ODN-CpG (B). Spleens were harvested and cultures were stimulated with D1 cells pulsed with the E743–77 long peptide. Subsequently, the percentage of CD4+ IFN-{gamma}-producing cells was analyzed by FACS. Open bars, The percentage of IFN-{gamma}-producing CD4+ T cells stimulated with nonpulsed D1 cells; filled bars, The percentage of IFN-{gamma}-producing CD4+ T cells stimulated with the long peptide-pulsed D1 cells. Each set of two bars represents an individual mouse. Spleens of naive mice were taken along as controls and stimulated in the same way, but the percentage of IFN-{gamma}-producing cells did not exceed the background on nonpulsed D1 cells (data not shown).

 
To study the role of CD40-mediated activation of APC by Th cells in the outcome of the CD8+ T cell response, CD40-/- mice were vaccinated twice with the long peptide (Fig. 1GoF). As expected, the number of E749–57-specific CD8+ T cells induced did not exceed that seen after one vaccination with the long peptide in wild-type B6 mice (Fig. 1GoB). In both groups of mice, one of the tested mice displayed a high percentage of tetramer-positive CD8+ T cells, but this has to be attributed to individual variation.

Single vaccinations with the E743–77 peptide and various DC-activating agents result in vigorous CD4+ and CD8+ T cell responses toward HPV16 E7

If the Th-mediated activation of professional APC is important for the observed robust CD8+ T cell response, direct activation of DC by itself should be sufficient to raise adequate CD8+ T cell responses. To address this point, B6 mice were vaccinated once with the long peptide or the minimal E749–57 peptide in combination with various DC-activating agents. IFA and Montanide (a human grade IFA) have been used extensively by us and others in previous studies. Mice vaccinated with either the short peptide or the long peptide combined with anti-CD40 Ab or GM-CSF in PBS displayed no or minimal CD8+ T cell responses (Fig. 3Go, A and B). However, the combination of GM-CSF and IFA resulted in moderate E749–57-specific CD8+ T cell responses when the long peptide was administered (Fig. 3GoC). Mice receiving the minimal peptide mixed with MPL or ODN-CpG showed clear-cut CD8+ T cell responses in several mice (Fig. 3Go, D and E), although the number of responders (4 of 9 and 4 of 12 mice, respectively) was not increased compared with mice vaccinated with IFA (Fig. 1GoA). In contrast, vaccination with the long peptide admixed with MPL or ODN-CpG resulted in E749–57-specific CD8+ T cell responses in all mice. Moreover, the level of the detected responses was high (up to 40% of stimulated CD8+ T cells) in the majority of animals.



View larger version (24K):
[in this window]
[in a new window]
 
FIGURE 3. One vaccination with the E743–77 long peptide combined with various DC-activating adjuvants results in high CD8+ T cell responses. Mice (B6) were vaccinated once with the short E749–57 peptide or the long peptide. Anti-CD40 Ab (A), GM-CSF (B), GM-CSF plus IFA (C), MPL (D), and ODN-CpG (E) were used as adjuvants. Similarly, MHC class II-/- mice (F) and CD40-/- mice (G) were vaccinated once with the long peptide and ODN-CpG. Spleens were harvested 10 days after priming and cultures were stimulated with the E749–57-expressing tumor cell line 13.2 for 1 wk. Subsequently, the percentage of E749–57 tetramer-positive CD8+ cells was determined by FACS analysis. Each bar represents an individual mouse. Horizontal lines indicate background responses plus SD of naive mice.

 
To confirm that both functional CD8+ and CD4+ T cell responses were triggered following a single vaccination with the long peptide and DC-activating agents, the numbers of CD8+ and CD4+ IFN-{gamma}-producing cells were measured upon stimulation with the short and long peptides, respectively. High numbers of IFN{gamma}-producing CD8+ T cells were detected, confirming that the CD8+ T cells detected by the H2-Db E749–57 tetramers were functionally active (data not shown). Compared with the use of IFA as adjuvant (Fig. 2GoA), the use of the DC-activating agent (ODN-CpG) raised even higher numbers of E743–77-specific IFN-{gamma}-producing CD4+ T cells (15–20% of stimulated CD4+ T cells; Fig. 2GoB).

Our prime-boost experiments with the long peptide (Fig. 1Go, D–F) suggested that the induction of high numbers of HPV-specific CD8+ T cells was the result of the activation of APC by HPV-specific CD4+ T cells. Therefore, direct activation of DC should be able to bypass a lack of T cell help and as such no difference in the numbers of HPV-specific CD8+ T cells among MHC class II-/- mice, CD40-/- mice, or wild-type mice after vaccination with the long peptide and a DC-activating agent is expected. To address this question, mice were vaccinated with the long peptide and ODN-CpG. As shown in Fig. 3Go, F and G, robust CD8+ T cell responses were detected in all types of mice after one vaccination. Together with the experiments shown in Fig. 1Go, these experiments show that proper precursor T cells are present in all types of mice. Furthermore, it demonstrates that activation of professional APC is an important aspect in the induction of high numbers of HPV-specific CD8+ T cells. Furthermore, the observation that in this Th-independent setting vaccination with the long peptide is superior to vaccination with the short peptide suggests that, compared with the minimal CTL epitope that may bind to MHC class I molecules present on all nucleated cells, the long peptide is preferentially processed and presented by professional APCs.

Vaccinations with the long E743–77 peptide and the DC-activating adjuvant ODN-CpG can effectively eradicate HPV16-expressing tumors

Numerous studies show that protection of C57BL/6 mice against HPV16 E7-expressing tumors is entirely dependent on E749–57-specific CD8+ T cells (13, 41, 42, 51). These CD8+ CTL are able to kill the HPV16 E7-expressing epithelial tumor cell line TC-1 (42, 51). Because it was shown that the percentage of E749–57 tetramer-positive CD8+ T cells correlated with cytotoxicity (48), the antitumor efficacy of the short peptide or the long peptide vaccine admixed with ODN-CpG, which consistently resulted in high numbers of CD8+ T cells, was tested by therapeutically vaccinating tumor-bearing mice in the contralateral flank (Fig. 4Go). Vaccinations with the short or the long peptide combined with IFA were taken along for comparison (Fig. 4Go). Notably, the vaccinations were given at the time that tumors were palpable in all mice (day 10). Based on a pilot experiment in which tumors treated with one single vaccination occasionally progressed after initial regression (data not shown), a booster vaccination was administered 14 days later to fully sustain E7-specific Th and CTL immunity. Compared with nonvaccinated mice (Fig. 4GoA), administration of the peptides in IFA showed some delay in tumor growth but all mice had died by day 50 (Fig. 4Go, D and E). In both groups treated with either the short or the long peptides combined with ODN-CpG, inhibition of tumor growth was seen 8–12 days after treatment (Fig. 4Go, B and C). Complete eradication of the TC-1 tumor was observed in three of nine mice treated with the short peptide and ODN-CpG (Fig. 4GoB) and in 2 of 10 control mice who, as a control, received two injections of ODN-CpG peritumoral (Fig. 5Go). In all of the control mice injected with ODN-CpG in the contralateral flank, tumor growth was comparable to nontreated animals (Fig. 5Go). In contrast, 8 of 10 mice treated with the long peptide and ODN-CpG completely eradicated their tumors, some of them sizing up to 250 mm3 (Fig. 4GoC). The mice with the two largest tumors (up to 500 mm3) initially succeeded in reducing the tumors to a size that was not palpable anymore, but eventually the tumors became detectable again and progressive tumor growth developed. One of these mice died spontaneously, whereas the other was killed to investigate the tumor, bearing in mind the possibility that recurrence may have resulted from escape mechanisms. The recognition of this excised tumor by two tumor-specific CTL clones was compared with that of the original in vitro growing tumor cell line (Fig. 6Go). Clearly, the recognition of the original tumor cells was far higher in comparison to the excised tumor, indicating that escape may have occurred through reduced CTL killing. Additional FACS analysis showed a 2-fold decreased expression of Kb and Db MHC class I molecules on the cell surface of the excised tumor (data not shown). Because TC-1 already expresses low levels of Kb and Db on its surface, further down-regulation of the MHC class I molecules may be one of the multiple mechanisms through which this tumor could have escaped from the immune system.



View larger version (37K):
[in this window]
[in a new window]
 
FIGURE 4. Prime-boost vaccinations with the E743–77 long peptide combined with the DC-activating agent ODN-CpG can eradicate large established tumors. B6 mice (n = 10) were challenged on day 0 with 5 x 104 HPV16-expressing tumor cells (TC-1) and primed, when all tumors were palpable, on day 10 and boosted 14 days later with either ODN-CpG plus the short peptide (B), with ODN-CpG plus the long peptide (C), or with IFA plus the short peptide (D) and IFA plus the long peptide (E). Untreated mice were taken along as a control (A). Mice were killed when the tumor size reached 1000 mm3. One of the mice in B developed an i.p. tumor that could not be measured over time. This animal was killed and excluded from the experiment. One of the two mice that developed progressive tumors in C died spontaneously, while the other was killed before the tumor reached 1000 mm3 to investigate the tumor.

 


View larger version (36K):
[in this window]
[in a new window]
 
FIGURE 5. Peritumoral injection of ODN-CpG has only marginal effects on tumor growth. B6 mice were challenged on day 0 with 5 x 104 HPV16-expressing tumor cells (TC-1) and injected, when all tumors were palpable, on day 10 and 14 days later with ODN-CpG, either in the contralateral flank (A) or peritumoral (B). The data of untreated mice are not shown but were similar to those depicted in Fig. 4GoA. One of the mice in A died spontaneously. Two mice in B were tumor free when the experiment was terminated at day 80. Compared with untreated mice there was no statistically significant prolongation of survival.

 


View larger version (11K):
[in this window]
[in a new window]
 
FIGURE 6. A progressively growing HPV16-expressing tumor displays tumor escape mechanisms. The tumor of one of the two mice that developed progressive tumors despite vaccination with the long peptide plus ODN-CpG (see Fig. 4GoC) was excised and tested after two in vitro passages for recognition by two tumor-specific CTL clones by measuring IFN-{gamma} production. The original in vitro growing HPV16-expressing tumor cell line TC-1 was used for comparison. The CTL clone 9.5 recognizes the HPV16 E749–57 peptide in a Db context, while the CTL clone 1H11 recognizes a p53-derived Kb-restricted epitope that is highly expressed by TC-1 as we have previously shown (33 ). The CTL clone 9.42 recognizes a nonrelevant epitope and was used as a control. IFN-{gamma} was added to both in vitro tumor cell cultures 48 h before testing to achieve maximum expression of MHC class I. Indicated is IFN-{gamma} production after stimulation with the original TC-1 tumor cell line (filled bars) and with the excised tumor (open bars).

 
Comparison of the survival time of TC-1-bearing mice showed that there was no significant difference between mice treated with the minimal CTL epitope mixed with IFA or ODN-CpG, mice treated with the long peptide in IFA, or untreated animals (Fig. 7Go). Mice treated with the long peptide admixed with ODN-CpG survived significantly longer (Kaplan-Meier analysis, p < 0.05). These in vivo data are consistent with the in vitro analysis of the CD4+ and CD8+ T cell responses after vaccination with the peptides in IFA or mixed with ODN-CpG.



View larger version (22K):
[in this window]
[in a new window]
 
FIGURE 7. Vaccination with the E743–77 long peptide and ODN-CpG results in prolonged survival. The mice described in Fig. 4Go were killed when the tumor size reached 1000 mm3 to avoid unnecessary suffering. Notably, one of the mice treated with the long peptide plus ODN-CpG (see Fig. 4GoC) was killed to investigate the tumor before it had reached 1000 mm3. The survival of mice treated with ODN-CpG and the long peptide was significantly increased compared with untreated mice (p < 0.05). Only two mice developed tumors while eight were totally tumor free at the time the experiment was terminated (at day 80).

 
Together these data demonstrate that it is essential to activate DC and induce high numbers of tumor-specific T cells to obtain effective antitumor responses.


    Discussion
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
In this study we show that the HPV16 E7-specific CD8+ T cell response is far more vigorous after vaccination with a HPV16 E7-derived 35-residue long peptide than following vaccination with the minimal CTL epitope. Our data suggest that two distinct DC-related mechanisms lie at the basis of this result. First, the long peptide contains both a CTL epitope and a Th epitope. Prime-boost vaccinations of wild-type, MHC class II-/-, and CD40-/- mice show that the CD40-CD40L interactions between APC and E7-specific Th cells contribute considerably to the level of the CD8+ T cell response. Second, under circumstances excluding T cell help, a comparison of the CD8+ T cell responses induced by either the minimal CTL epitope (nine residues) or the long peptide combined with DC-activating agents demonstrates that vaccination with the long peptide results in far better responses. This suggests that compared with the short minimal CTL epitope the long peptide is much better presented by professional APC. Additionally, we show that prime-boost vaccinations with the long peptide and the strong DC-activating adjuvant ODN-CpG lead to the complete eradication of established tumors. These data provide a scientific basis for the use of long overlapping peptides, alone or in combination with strong DC-activating agents, in future clinical trials.

The high efficacy of our long peptide vaccine may partly result from the fact that the Th and CTL epitope are physically linked to each other, although we have not tested this in the current study. The potential advantage of epitope linkage lies in the increased chance for simultaneous presentation of both the MHC class I- and class II-restricted epitopes on the surface of a single APC, thereby facilitating the delivery of cognate T cell help to CTL priming. A direct comparison of vaccines that used a mixture of nonlinked CTL and Th epitopes with vaccines that used identical, but physically linked, CTL and Th epitopes demonstrated that the latter resulted in more vigorous CTL responses (26, 27, 28, 29). Naturally occurring epitope linkage can be found in most protein Ags, including the HIV-1 envelope protein (52), the IDDM-associated GAD65 protein (53), and the Her-2/neu protein (54). Interestingly, recent vaccinations with Her-2 peptides, comprising both CTL and Th epitopes, resulted in enhanced Her-2-specific Th and CTL activity in cancer patients (54). Our experiments in wild-type B6 and MHC class II-/- mice show that simultaneous vaccination with both CTL and Th epitopes is advantageous for the development of a strong E7-specific CD8+ T cell response. In addition, the experiments in CD40-/- mice demonstrate that particularly the interaction of CD40-CD40L between E7-specific Th cells and APC is responsible for this boost of the CD8+ T cell response.

Comparison of the CD8+ T cell responses induced after a single vaccination with the short peptide or the 35-residue long peptide in combination with DC-activating adjuvants revealed another interesting property of the long peptide vaccine. Under these circumstances the contribution of E7-specific Th cells is negligible because at priming their number is too low to exert this function. Consequently, only differences in physical properties or kinetics of the peptides are likely to play a role. Because of its size, which excludes direct binding to MHC class I molecules, the long peptide has to be taken up by professional APC that are able to process exogenously derived Ags for presentation in MHC class I molecules (55). We demonstrate that direct activation of APC with DC-activating agents, bypassing the need for T cell help, only marginally affects the outcome of the E7-specific CD8+ T cell response when the minimal peptide is used, whereas DC activation induces a superior E7-specific CD8+ T cell response when the long peptide is administered. To confirm that T cell help was not responsible for this effect, the long peptide was coinjected with the DC-activating adjuvant ODN-CpG in MHC class II-/- and CD40-/- mice and, as expected, the observed CD8+ T cell responses were comparable to those seen in wild-type mice. The superior CD8+ T cell-inducing capacity of long peptides plus DC-activating agents over short peptides can be explained by the fact that minimal CTL epitopes show no distinction between MHC class I molecules present on professional APC or the MHC class I molecules on other nucleated cells. In the absence of expression of proper costimulatory molecules, such nonprofessional APC have been shown to exert tolerizing influences on CTL precursors (40). Additionally, long peptides need to be taken up and processed by professional APC. The use of specific DC-activating agents affected especially CD8+ T cell induction by the long peptide vaccine, suggesting that the long peptides are indeed taken up and processed by professional APC. This may create an intracellular reservoir for continuous supply of MHC class II- and MHC class I-bound peptides to the cell surface and as such lead to sustained CD8+ T cell activation. Exact MHC class I-binding short peptides have a short half life at the cell surface and DC loaded in vivo with such peptides will not benefit from resupply to the cell surface from internally processed stores of Ag (56). Finally, recent experiments performed in our department indicate that ODN-CpG not only activates DC but can also improve the MHC class I peptide processing pathway, leading to an increased number of available CTL epitopes on the cell surface of the DC (F. Ossendorp M. Camps, A. Sijts, P. Kloetzel, and C. J. M. Melief, unpublished observations).

We and others have completed phase I/II vaccination studies in which HPV16+ patients were vaccinated with CTL epitopes admixed with Montanide (12, 15), a human grade of IFA with similar properties (57), or admixed with Montanide plus a nonlinked universal Th epitope (14). All together, no or marginal HPV16 CTL responses were detected in these patients. Our data show that minimal peptide epitopes mixed with mineral oil based adjuvants, such as Montanide or IFA, trigger only marginal CD8+ T cell responses in prime-boost regimens. As shown here, the inclusion of a Th epitope markedly improves the vaccine. Increasing the size of the peptide, forcing it to be presented by professional APC, is another way to enhance the vaccination efficacy. In addition, the strength of the vaccine can be further improved by the use of DC-activating adjuvants. We demonstrate that the DC-activating agents MPL (a detoxified form of LPS that can be used in humans) (33), ODN-CpG, and the DC-activating chemokine GM-CSF in IFA help increasing the levels of CD8+ T cell responses induced by the long HPV16 E7-derived peptide. Interestingly, this DC activation also results in increased levels of E7-specific CD4+ Th cells, which may additionally enhance and sustain HPV-specific CTL responses. Indeed, the combination of the DC-activating agent ODN-CpG and the long peptide proved to result in complete eradication of established tumors following prime-boost vaccinations. These data are in line with the results of a recent study, which demonstrated that ODN-CpG markedly enhance the number of tumor-specific CTL (58).

Based on our data, we conclude that vaccination with long peptides containing both CTL and Th cell epitopes and DC-activating agents can contribute to the design of stronger HPV vaccines. We have now initiated a phase I/II study in which a clinically grade long (32–35 residues) overlapping peptide vaccine, covering the entire HPV16 E6 and E7 protein, is used to vaccinate patients with HPV16-induced cervical or vulvar lesions.


    Acknowledgments
 
We thank W. Benckhuisen for peptide synthesis and Dr. F. Ossendorp and Dr. T. van Hall for critical reading of the manuscript.


    Footnotes
 
1 This work was supported by grants from the Dutch Organization for Scientific Research (Grant 920-03-094 to S.Z.), the Cancer Research Institute (to S.H.v.d.B.), the Dutch Cancer Society (RUL 99-2024 and 2000-2200 to R.O. and C.J.M.M.), and the European Community (Grant QLK2-CT-2000-00470). Back

2 S.H.v.d.B. and C.J.M.M. contributed equally to this work. Back

3 Address correspondence and reprint requests to Dr. Cornelius J. M. Melief, Department of Immunohematology and Blood Transfusion, Building 1, E3-Q, Leiden University Medical Center, P.O. Box 9600, 2300 RC Leiden, The Netherlands. E-mail address: cmelief{at}lumc.nl Back

4 Abbreviations used in this paper: HPV, human papillomavirus; DC, dendritic cell; MPL, monophosphoryl lipid A; ODN, oligodeoxynucleotide; CD40L, CD40 ligand. Back

Received for publication February 27, 2002. Accepted for publication April 29, 2002.


    References
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 

  1. zur Hausen, H.. 1996. Papillomavirus infections: a major cause of human cancers. Biochim. Biophys. Acta 1288:F55.[Medline]
  2. Bosch, F. X., M. M. Manos, N. Munoz, M. Sherman, A. M. Jansen, J. Peto, M. H. Schiffman, V. Moreno, R. Kurman, K. V. Shah. 1995. Prevalence of human papillomavirus in cervical cancer: a worldwide perspective. J. Natl. Cancer Inst. 87:796.[Abstract/Free Full Text]
  3. Melief, C. J., R. E. Toes, J. P. Medema, S. H. van der Burg, F. Ossendorp, R. Offringa. 2000. Strategies for immunotherapy of cancer. Adv. Immunol. 75:235.[Medline]
  4. Duggan, M. A., S. E. McGregor, G. C. Stuart, S. Morris, V. Chang-Poon, A. Schepansky, L. Honore. 1998. The natural history of CIN I lesions. Eur. J. Gynaecol. Oncol. 19:338.[Medline]
  5. Evander, M., K. Edlund, A. Gustafsson, M. Jonsson, R. Karlsson, E. Rylander, G. Wadell. 1995. Human papillomavirus infection is transient in young women: a population-based cohort study. J. Infect. Dis. 171:1026.[Medline]
  6. Ho, G. Y., R. Bierman, L. Beardsley, C. J. Chang, R. D. Burk. 1998. Natural history of cervicovaginal papillomavirus infection in young women. N. Engl. J. Med. 338:423.[Abstract/Free Full Text]
  7. Aiba, S., M. Rokugo, H. Tagami. 1986. Immunohistologic analysis of the phenomenon of spontaneous regression of numerous flat warts. Cancer 58:1246.[Medline]
  8. Coleman, N., H. D. Birley, A. M. Renton, N. F. Hanna, B. K. Ryait, M. Byrne, D. Taylor-Robinson, M. A. Stanley. 1994. Immunological events in regressing genital warts. Am. J. Clin. Pathol. 102:768.[Medline]
  9. Petry, K. U., D. Scheffel, U. Bode, T. Gabrysiak, H. Kochel, E. Kupsch, M. Glaubitz, S. Niesert, H. Kuhnle, I. Schedel. 1994. Cellular immunodeficiency enhances the progression of human papillomavirus-associated cervical lesions. Int. J. Cancer 57:836.[Medline]
  10. Chirgwin, K. D., J. Feldman, M. Augenbraun, S. Landesman, H. Minkoff. 1995. Incidence of venereal warts in human immunodeficiency virus-infected and uninfected women. J. Infect. Dis. 172:235.[Medline]
  11. Coulie, P. G., V. Karanikas, D. Colau, C. Lurquin, C. Landry, M. Marchand, T. Dorval, V. Brichard, T. Boon. 2001. A monoclonal cytolytic T-lymphocyte response observed in a melanoma patient vaccinated with a tumor-specific antigenic peptide encoded by gene MAGE-3. Proc. Natl. Acad. Sci. USA 98:10290.[Abstract/Free Full Text]
  12. Muderspach, L., S. Wilczynski, L. Roman, L. Bade, J. Felix, L. A. Small, W. M. Kast, G. Fascio, V. Marty, J. Weber. 2000. A phase I trial of a human papillomavirus (HPV) peptide vaccine for women with high-grade cervical and vulvar intraepithelial neoplasia who are HPV 16 positive. Clin. Cancer Res. 6:3406.[Abstract/Free Full Text]
  13. Feltkamp, M. C., H. L. Smits, M. P. Vierboom, R. P. Minnaar, B. M. de Jongh, J. W. Drijfhout, J. ter Schegget, C. J. Melief, W. M. Kast. 1993. Vaccination with cytotoxic T lymphocyte epitope-containing peptide protects against a tumor induced by human papillomavirus type 16-transformed cells. Eur. J. Immunol. 23:2242.[Medline]
  14. Ressing, M. E., W. J. van Driel, R. M. Brandt, G. G. Kenter, J. H. de Jong, T. Bauknecht, G. J. Fleuren, P. Hoogerhout, R. Offringa, A. Sette, et al 2000. Detection of T helper responses, but not of human papillomavirus-specific cytotoxic T lymphocyte responses, after peptide vaccination of patients with cervical carcinoma. J. Immunother. 23:255.
  15. Steller, M. A., K. J. Gurski, M. Murakami, R. W. Daniel, K. V. Shah, E. Celis, A. Sette, E. L. Trimble, R. C. Park, F. M. Marincola. 1998. Cell-mediated immunological responses in cervical and vaginal cancer patients immunized with a lipidated epitope of human papillomavirus type 16 E7. Clin. Cancer Res. 4:2103.[Abstract]
  16. Ossendorp, F., E. Mengede, M. Camps, R. Filius, C. J. Melief. 1998. Specific T helper cell requirement for optimal induction of cytotoxic T lymphocytes against major histocompatibility complex class II negative tumors. J. Exp. Med. 187:693.[Abstract/Free Full Text]
  17. Ossendorp, F., R. E. Toes, R. Offringa, S. H. van der Burg, C. J. Melief. 2000. Importance of CD4+ T helper cell responses in tumor immunity. Immunol. Lett. 74:75.[Medline]
  18. Greenberg, P. D.. 1991. Adoptive T cell therapy of tumors: mechanisms operative in the recognition and elimination of tumor cells. Adv. Immunol. 49:281.[Medline]
  19. Schild, H. J., B. Kyewski, P. Von Hoegen, V. Schirrmacher. 1987. CD4+ helper T cells are required for resistance to a highly metastatic murine tumor. Eur. J. Immunol. 17:1863.[Medline]
  20. Romerdahl, C. A., M. L. Kripke. 1988. Role of helper T-lymphocytes in rejection of UV-induced murine skin cancers. Cancer Res. 48:2325.[Abstract/Free Full Text]
  21. Bennett, S. R., F. R. Carbone, F. Karamalis, R. A. Flavell, J. F. Miller, W. R. Heath. 1998. Help for cytotoxic-T-cell responses is mediated by CD40 signalling. Nature 393:478.[Medline]
  22. Ridge, J. P., F. Di Rosa, P. Matzinger. 1998. A conditioned dendritic cell can be a temporal bridge between a CD4+ T-helper and a T-killer cell. Nature 393:474.[Medline]
  23. Schoenberger, S. P., R. E. Toes, E. I. van der Voort, R. Offringa, C. J. Melief. 1998. T-cell help for cytotoxic T lymphocytes is mediated by CD40-CD40L interactions. Nature 393:480.[Medline]
  24. Snijders, A., P. Kalinski, C. M. Hilkens, M. L. Kapsenberg. 1998. High-level IL-12 production by human dendritic cells requires two signals. Int. Immunol. 10:1593.[Abstract/Free Full Text]
  25. Kast, W. M., A. M. Bronkhorst, L. P. de Waal, C. J. Melief. 1986. Cooperation between cytotoxic and helper T lymphocytes in protection against lethal Sendai virus infection: protection by T cells is MHC-restricted and MHC-regulated: a model for MHC-disease associations. J. Exp. Med. 164:723.[Abstract/Free Full Text]
  26. Shirai, M., C. D. Pendleton, J. Ahlers, T. Takeshita, M. Newman, J. A. Berzofsky. 1994. Helper CTL determinant linkage required for priming of anti-HIV CD8+ CTL in vivo with peptide vaccine constructs. J. Immunol. 152:549.[Abstract]
  27. Partidos, C. D., P. Vohra, M. W. Steward. 1996. Induction of measles virus-specific cytotoxic T-cell responses after intranasal immunization with synthetic peptides. Immunology 87:179.[Medline]
  28. Hiranuma, K., S. Tamaki, Y. Nishimura, S. Kusuki, M. Isogawa, G. Kim, M. Kaito, K. Kuribayashi, Y. Adachi, Y. Yasutomi. 1999. Helper T cell determinant peptide contributes to induction of cellular immune responses by peptide vaccines against hepatitis C virus. J. Gen. Virol. 80:187.[Abstract]
  29. Bristol, J. A., C. Orsini, P. Lindinger, J. Thalhamer, S. I. Abrams. 2000. Identification of a ras oncogene peptide that contains both CD4+ and CD8+ T cell epitopes in a nested configuration and elicits both T cell subset responses by peptide or DNA immunization. Cell. Immunol. 205:73.[Medline]
  30. Sparwasser, T., E. S. Koch, R. M. Vabulas, K. Heeg, G. B. Lipford, J. W. Ellwart, H. Wagner. 1998. Bacterial DNA and immunostimulatory CpG oligonucleotides trigger maturation and activation of murine dendritic cells. Eur. J. Immunol. 28:2045.[Medline]
  31. Weiner, G. J., H. M. Liu, J. E. Wooldridge, C. E. Dahle, A. M. Krieg. 1997. Immunostimulatory oligodeoxynucleotides containing the CpG motif are effective as immune adjuvants in tumor antigen immunization. Proc. Natl. Acad. Sci. USA 94:10833.[Abstract/Free Full Text]
  32. Vabulas, R. M., H. Pircher, G. B. Lipford, H. Hacker, H. Wagner. 2000. CpG-DNA activates in vivo T cell epitope presenting dendritic cells to trigger protective antiviral cytotoxic T cell responses. J. Immunol. 164:2372.[Abstract/Free Full Text]
  33. Thompson, H. S., M. L. Davies, M. J. Watts, A. E. Mann, F. P. Holding, T. O’Neill, J. T. Beech, S. J. Thompson, G. D. Leesman, J. T. Ulrich. 1998. Enhanced immunogenicity of a recombinant genital warts vaccine adjuvanted with monophosphoryl lipid A. Vaccine 16:1993.[Medline]
  34. Ulrich, J. T., K. R. Myers. 1995. Monophosphoryl lipid A as an adjuvant: past experiences and new directions. Pharm. Biotechnol. 6:495.[Medline]
  35. Diehl, L., A. T. den Boer, S. P. Schoenberger, E. I. van der Voort, T. N. Schumacher, C. J. Melief, R. Offringa, R. E. Toes. 1999. CD40 activation in vivo overcomes peptide-induced peripheral cytotoxic T-lymphocyte tolerance and augments anti-tumor vaccine efficacy. Nat. Med. 5:774.[Medline]
  36. Disis, M. L., H. Bernhard, F. M. Shiota, S. L. Hand, J. R. Gralow, E. S. Huseby, S. Gillis, M. A. Cheever. 1996. Granulocyte-macrophage colony-stimulating factor: an effective adjuvant for protein and peptide-based vaccines. Blood 88:202.[Abstract/Free Full Text]
  37. Ressing, M. E., A. Sette, R. M. Brandt, J. Ruppert, P. A. Wentworth, M. Hartman, C. Oseroff, H. M. Grey, C. J. Melief, W. M. Kast. 1995. Human CTL epitopes encoded by human papillomavirus type 16 E6 and E7 identified through in vivo and in vitro immunogenicity studies of HLA-A*0201-binding peptides. J. Immunol. 154:5934.[Abstract]
  38. Kast, W. M., R. M. Brandt, J. Sidney, J. W. Drijfhout, R. T. Kubo, H. M. Grey, C. J. Melief, A. Sette. 1994. Role of HLA-A motifs in identification of potential CTL epitopes in human papillomavirus type 16 E6 and E7 proteins. J. Immunol. 152:3904.[Abstract]
  39. van der Burg, S. H., M. E. Ressing, K. M. Kwappenberg, A. de Jong, K. Straathof, J. de Jong, A. Geluk, K. E. van Meijgaarden, K. L. Franken, T. H. Ottenhoff, et al 2001. Natural T-helper immunity against human papillomavirus type 16 (HPV16) E7-derived peptide epitopes in patients with HPV16-positive cervical lesions: identification of 3 human leukocyte antigen class II-restricted epitopes. Int. J. Cancer 91:612.[Medline]
  40. Toes, R. E., E. I. van der Voort, S. P. Schoenberger, J. W. Drijfhout, L. van Bloois, G. Storm, W. M. Kast, R. Offringa, C. J. Melief. 1998. Enhancement of tumor outgrowth through CTL tolerization after peptide vaccination is avoided by peptide presentation on dendritic cells. J. Immunol. 160:4449.[Abstract/Free Full Text]
  41. Lin, K. Y., F. G. Guarnieri, K. F. Staveley-O’Carroll, H. I. Levitsky, J. T. August, D. M. Pardoll, T. C. Wu. 1996. Treatment of established tumors with a novel vaccine that enhances major histocompatibility class II presentation of tumor antigen. Cancer Res. 56:21.[Abstract/Free Full Text]
  42. De Bruijn, M. L., D. H. Schuurhuis, M. P. Vierboom, H. Vermeulen, K. A. de Cock, M. E. Ooms, M. E. Ressing, M. Toebes, K. L. Franken, J. W. Drijfhout, et al 1998. Immunization with human papillomavirus type 16 (HPV16) oncoprotein-loaded dendritic cells as well as protein in adjuvant induces MHC class I-restricted protection to HPV16-induced tumor cells. Cancer Res. 58:724.[Abstract/Free Full Text]
  43. Vierboom, M. P., H. W. Nijman, R. Offringa, E. I. van der Voort, T. van Hall, L. van den Broek, G. J. Fleuren, P. Kenemans, W. M. Kast, C. J. Melief. 1997. Tumor eradication by wild-type p53-specific cytotoxic T lymphocytes. J. Exp. Med. 186:695.[Abstract/Free Full Text]
  44. van Hall, T., N. E. van de Rhee, S. P. Schoenberger, M. P. Vierboom, F. A. Verreck, C. J. Melief, R. Offringa. 1998. Cryptic open reading frames in plasmid vector backbone sequences can provide highly immunogenic cytotoxic T-lymphocyte epitopes. Cancer Res. 58:3087.[Abstract/Free Full Text]
  45. Winzler, C., P. Rovere, M. Rescigno, F. Granucci, G. Penna, L. Adorini, V. S. Zimmermann, J. Davoust, P. Ricciardi-Castagnoli. 1997. Maturation stages of mouse dendritic cells in growth factor-dependent long-term cultures. J. Exp. Med. 185:317.[Abstract/Free Full Text]
  46. Rescigno, M., C. Winzler, D. Delia, C. Mutini, M. Lutz, P. Ricciardi-Castagnoli. 1997. Dendritic cell maturation is required for initiation of the immune response. J. Leukocyte Biol. 61:415.[Medline]
  47. Tindle, R. W., G. J. Fernando, J. C. Sterling, I. H. Frazer. 1991. A "public" T-helper epitope of the E7 transforming protein of human papillomavirus 16 provides cognate help for several E7 B-cell epitopes from cervical cancer-associated human papillomavirus genotypes. Proc. Natl. Acad. Sci. USA 88:5887.[Abstract/Free Full Text]
  48. van der Burg, S. H., K. M. Kwappenberg, T. O’Neill, R. M. Brandt, C. J. Melief, J. K. Hickling, R. Offringa. 2001. Pre-clinical safety and efficacy of TA-CIN, a recombinant HPV16 L2E6E7 fusion protein vaccine, in homologous and heterologous prime-boost regimens. Vaccine 19:3652.[Medline]
  49. Rogers, P. R., C. Dubey, S. L. Swain. 2000. Qualitative changes accompany memory T cell generation: faster, more effective responses at lower doses of antigen. J. Immunol. 164:2338.[Abstract/Free Full Text]
  50. Vierboom, M. P., S. Zwaveling, G. M. J. Bos, M. Ooms, G. M. Krietemeijer, C. J. Melief, R. Offringa. 2000. High steady-state levels of p53 are not a prerequisite for tumor eradication by wild-type p53-specific cytotoxic T lymphocytes. Cancer Res. 60:5508.[Abstract/Free Full Text]
  51. Greenstone, H. L., J. D. Nieland, K. E. de Visser, M. L. De Bruijn, R. Kirnbauer, R. B. Roden, D. R. Lowy, W. M. Kast, J. T. Schiller. 1998. Chimeric papillomavirus virus-like particles elicit antitumor immunity against the E7 oncoprotein in an HPV16 tumor model. Proc. Natl. Acad. Sci. USA 95:1800.[Abstract/Free Full Text]
  52. Takahashi, H., R. N. Germain, B. Moss, J. A. Berzofsky. 1990. An immunodominant class I-restricted cytotoxic T lymphocyte determinant of human immunodeficiency virus type 1 induces CD4 class II-restricted help for itself. J. Exp. Med. 171:571.[Abstract/Free Full Text]
  53. Ou, D., L. A. Jonsen, D. L. Metzger, A. J. Tingle. 1999. CD4+ and CD8+ T-cell clones from congenital rubella syndrome patients with IDDM recognize overlapping GAD65 protein epitopes: implications for HLA class I and II allelic linkage to disease susceptibility. Hum. Immunol. 60:652.[Medline]
  54. Knutson, K. L., K. Schiffman, M. L. Disis. 2001. Immunization with a HER-2/neu helper peptide vaccine generates HER-2/neu CD8 T-cell immunity in cancer patients. J. Clin. Invest. 107:477.[Medline]
  55. Reimann, J., S. H. Kaufmann. 1997. Alternative antigen processing pathways in anti-infective immunity. Curr. Opin. Immunol. 9:462.[Medline]
  56. Lanzavecchia, A., F. Sallusto. 2001. Antigen decoding by T lymphocytes: from synapses to fate determination. Nat. Immunol. 2:487.[Medline]
  57. Ahlers, J. D., N. Dunlop, C. D. Pendleton, M. Newman, P. L. Nara, J. A. Berzofsky. 1996. Candidate HIV type 1 multideterminant cluster peptide-P18MN vaccine constructs elicit type 1 helper T cells, cytotoxic T cells, and neutralizing antibody, all using the same adjuvant immunization. AIDS Res. Hum. Retroviruses 12:259.[Medline]
  58. Miconnet, I., S. Koenig, D. Speiser, A. Krieg, P. Guillaume, J. C. Cerottini, P. Romero. 2002. CpG are efficient adjuvants for specific CTL induction against tumor antigen-derived peptide. J. Immunol. 168:1212.[Abstract/Free Full Text]



This article has been cited by other articles:


Home page
NEJMHome page
G. G. Kenter, M. J.P. Welters, A. R. P.M. Valentijn, M. J.G. Lowik, D. M.A. Berends-van der Meer, A. P.G. Vloon, F. Essahsah, L. M. Fathers, R. Offringa, J. W. Drijfhout, et al.
Vaccination against HPV-16 Oncoproteins for Vulvar Intraepithelial Neoplasia
N. Engl. J. Med., November 5, 2009; 361(19): 1838 - 1847.
[Abstract] [Full Text] [PDF]


Home page
NEJMHome page
O. J. Finn and R. P. Edwards
Human Papillomavirus Vaccine for Cancer Prevention
N. Engl. J. Med., November 5, 2009; 361(19): 1899 - 1901.
[Full Text] [PDF]


Home page
Clin. Cancer Res.Home page
F. M. Speetjens, P. J.K. Kuppen, M. J.P. Welters, F. Essahsah, A. M. E.G. Voet van den Brink, M. G. K. Lantrua, A. R. P.M. Valentijn, J. Oostendorp, L. M. Fathers, H. W. Nijman, et al.
Induction of p53-Specific Immunity by a p53 Synthetic Long Peptide Vaccine in Patients Treated for Metastatic Colorectal Cancer
Clin. Cancer Res., February 1, 2009; 15(3): 1086 - 1095.
[Abstract] [Full Text] [PDF]


Home page
Clin. Cancer Res.Home page
P. J. de Vos van Steenwijk, S. J. Piersma, M. J.P. Welters, J. M. van der Hulst, G. Fleuren, B. W.J. Hellebrekers, G. G. Kenter, and S. H. van der Burg
Surgery followed by Persistence of High-Grade Squamous Intraepithelial Lesions Is Associated with the Induction of a Dysfunctional HPV16-Specific T-Cell Response
Clin. Cancer Res., November 15, 2008; 14(22): 7188 - 7195.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
D. Atanackovic, N. K. Altorki, Y. Cao, E. Ritter, C. A. Ferrara, G. Ritter, E. W. Hoffman, C. Bokemeyer, L. J. Old, and S. Gnjatic
Booster vaccination of cancer patients with MAGE-A3 protein reveals long-term immunological memory or tolerance depending on priming
PNAS, February 5, 2008; 105(5): 1650 - 1655.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
M. M. Lauwen, S. Zwaveling, L. de Quartel, S. C. Ferreira Mota, J. A.C. Grashorn, C. J.M. Melief, S. H. van der Burg, and R. Offringa
Self-Tolerance Does Not Restrict the CD4+ T-Helper Response against the p53 Tumor Antigen
Cancer Res., February 1, 2008; 68(3): 893 - 900.
[Abstract] [Full Text] [PDF]


Home page
Clin. Cancer Res.Home page
G. G. Kenter, M. J.P. Welters, A.R. P.M. Valentijn, M. J.G. Lowik, D. M.A. Berends-van der Meer, A. P.G. Vloon, J. W. Drijfhout, A. R. Wafelman, J. Oostendorp, G. J. Fleuren, et al.
Phase I Immunotherapeutic Trial with Long Peptides Spanning the E6 and E7 Sequences of High-Risk Human Papillomavirus 16 in End-Stage Cervical Cancer Patients Shows Low Toxicity and Robust Immunogenicity
Clin. Cancer Res., January 1, 2008; 14(1): 169 - 177.
[Abstract] [Full Text] [PDF]


Home page
Clin. Cancer Res.Home page
M. J.P. Welters, G. G. Kenter, S. J. Piersma, A. P.G. Vloon, M. J.G. Lowik, D. M.A. Berends-van der Meer, J. W. Drijfhout, A. R. P.M. Valentijn, A. R. Wafelman, J. Oostendorp, et al.
Induction of Tumor-Specific CD4+ and CD8+ T-Cell Immunity in Cervical Cancer Patients by a Human Papillomavirus Type 16 E6 and E7 Long Peptides Vaccine
Clin. Cancer Res., January 1, 2008; 14(1): 178 - 187.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
R. Bos, S. van Duikeren, T. van Hall, M. M. Lauwen, M. Parrington, N. L. Berinstein, B. McNeil, C. J. M. Melief, J. S. Verbeek, S. H. van der Burg, et al.
Characterization of Antigen-Specific Immune Responses Induced by Canarypox Virus Vaccines
J. Immunol., November 1, 2007; 179(9): 6115 - 6122.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
M. S. Bijker, S. J. F. van den Eeden, K. L. Franken, C. J. M. Melief, R. Offringa, and S. H. van der Burg
CD8+ CTL Priming by Exact Peptide Epitopes in Incomplete Freund's Adjuvant Induces a Vanishing CTL Response, whereas Long Peptides Induce Sustained CTL Reactivity
J. Immunol., October 15, 2007; 179(8): 5033 - 5040.
[Abstract] [Full Text] [PDF]


Home page
Clin. Cancer Res.Home page
R. J. May, T. Dao, J. Pinilla-Ibarz, T. Korontsvit, V. Zakhaleva, R. H. Zhang, P. Maslak, and D. A. Scheinberg
Peptide Epitopes from the Wilms' Tumor 1 Oncoprotein Stimulate CD4+ and CD8+ T Cells That Recognize and Kill Human Malignant Mesothelioma Tumor Cells
Clin. Cancer Res., August 1, 2007; 13(15): 4547 - 4555.
[Abstract] [Full Text] [PDF]


Home page
JEMHome page
S. Loeser, K. Loser, M. S. Bijker, M. Rangachari, S. H. van der Burg, T. Wada, S. Beissert, C. J.M. Melief, and J. M. Penninger
Spontaneous tumor rejection by cbl-b-deficient CD8+ T cells
J. Exp. Med., April 16, 2007; 204(4): 879 - 891.
[Abstract] [Full Text] [PDF]


Home page
Clin. Cancer Res.Home page
S. H. Bae, Y.-J. Park, J.-B. Park, Y. S. Choi, M. S. Kim, and J.-I. Sin
Therapeutic Synergy of Human Papillomavirus E7 Subunit Vaccines plus Cisplatin in an Animal Tumor Model: Causal Involvement of Increased Sensitivity of Cisplatin-Treated Tumors to CTL-Mediated Killing in Therapeutic Synergy
Clin. Cancer Res., January 1, 2007; 13(1): 341 - 349.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
J. N. Kochenderfer, C. D. Chien, J. L. Simpson, and R. E. Gress
Synergism between CpG-Containing Oligodeoxynucleotides and IL-2 Causes Dramatic Enhancement of Vaccine-Elicited CD8+ T Cell Responses
J. Immunol., December 15, 2006; 177(12): 8860 - 8873.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
G. Bioley, C. Jandus, S. Tuyaerts, D. Rimoldi, W. W. Kwok, D. E. Speiser, J.-M. Tiercy, K. Thielemans, J.-C. Cerottini, and P. Romero
Melan-A/MART-1-Specific CD4 T Cells in Melanoma Patients: Identification of New Epitopes and Ex Vivo Visualization of Specific T Cells by MHC Class II Tetramers
J. Immunol., November 15, 2006; 177(10): 6769 - 6779.
[Abstract] [Full Text] [PDF]


Home page
Arch Otolaryngol Head Neck SurgHome page
K. B. Gendron, A. Rodriguez, and D. A. Sewell
Vaccination with human papillomavirus type 16 e7 Peptide with CpG oligonucleotides for prevention of tumor growth in mice.
Arch Otolaryngol Head Neck Surg, March 1, 2006; 132(3): 327 - 332.
[Abstract] [Full Text] [PDF]


Home page
Int ImmunolHome page
D. Wakita, K. Chamoto, Y. Zhang, Y. Narita, D. Noguchi, H. Ohnishi, T. Iguchi, T. Sakai, H. Ikeda, and T. Nishimura
An indispensable role of type-1 IFNs for inducing CTL-mediated complete eradication of established tumor tissue by CpG-liposome co-encapsulated with model tumor antigen
Int. Immunol., March 1, 2006; 18(3): 425 - 434.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
Y. Motomura, S. Senju, T. Nakatsura, H. Matsuyoshi, S. Hirata, M. Monji, H. Komori, D. Fukuma, H. Baba, and Y. Nishimura
Embryonic Stem Cell-Derived Dendritic Cells Expressing Glypican-3, a Recently Identified Oncofetal Antigen, Induce Protective Immunity against Highly Metastatic Mouse Melanoma, B16-F10
Cancer Res., February 15, 2006; 66(4): 2414 - 2422.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
A. Baez-Astua, E. Herraez-Hernandez, N. Garbi, H. A. Pasolli, V. Juarez, H. zur Hausen, and A. Cid-Arregui
Low-Dose Adenovirus Vaccine Encoding Chimeric Hepatitis B Virus Surface Antigen-Human Papillomavirus Type 16 E7 Proteins Induces Enhanced E7-Specific Antibody and Cytotoxic T-Cell Responses
J. Virol., October 15, 2005; 79(20): 12807 - 12817.
[Abstract] [Full Text] [PDF]


Home page
Int ImmunolHome page
K. L. Smith, A. Tristram, K. M. Gallagher, A. N. Fiander, and S. Man
Epitope specificity and longevity of a vaccine-induced human T cell response against HPV18
Int. Immunol., February 1, 2005; 17(2): 167 - 176.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
X. Preville, D. Ladant, B. Timmerman, and C. Leclerc
Eradication of Established Tumors by Vaccination With Recombinant Bordetella pertussis Adenylate Cyclase Carrying the Human Papillomavirus 16 E7 Oncoprotein
Cancer Res., January 15, 2005; 65(2): 641 - 649.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
H. Shams, P. Klucar, S. E. Weis, A. Lalvani, P. K. Moonan, H. Safi, B. Wizel, K. Ewer, G. T. Nepom, D. M. Lewinsohn, et al.
Characterization of a Mycobacterium tuberculosis Peptide That Is Recognized by Human CD4+ and CD8+ T Cells in the Context of Multiple HLA Alleles
J. Immunol., August 1, 2004; 173(3): 1966 - 1977.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
T. F. Rowley and A. Al-Shamkhani
Stimulation by Soluble CD70 Promotes Strong Primary and Secondary CD8+ Cytotoxic T Cell Responses In Vivo
J. Immunol., May 15, 2004; 172(10): 6039 - 6046.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
E. H. Slager, C. E. van der Minne, M. Kruse, D. D. Krueger, M. Griffioen, and S. Osanto
Identification of Multiple HLA-DR-Restricted Epitopes of the Tumor-Associated Antigen CAMEL by CD4+ Th1/Th2 Lymphocytes
J. Immunol., April 15, 2004; 172(8): 5095 - 5102.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
H. L. Hanson, S. S. Kang, L. A. Norian, K. Matsui, L. A. O'Mara, and P. M. Allen
CD4-Directed Peptide Vaccination Augments an Antitumor Response, but Efficacy Is Limited by the Number of CD8+ T Cell Precursors
J. Immunol., April 1, 2004; 172(7): 4215 - 4224.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
Y.-F. Chen, C.-W. Lin, Y.-P. Tsao, and S.-L. Chen
Cytotoxic-T-Lymphocyte Human Papillomavirus Type 16 E5 Peptide with CpG-Oligodeoxynucleotide Can Eliminate Tumor Growth in C57BL/6 Mice
J. Virol., February 1, 2004; 78(3): 1333 - 1343.
[Abstract] [Full Text] [PDF]


Home page
BloodHome page
B. de Rijke, H. Fredrix, A. Zoetbrood, F. Scherpen, H. Witteveen, T. de Witte, E. van de Wiel-van Kemenade, and H. Dolstra
Generation of autologous cytotoxic and helper T-cell responses against the B-cell leukemia-associated antigen HB-1: relevance for precursor B-ALL-specific immunotherapy
Blood, October 15, 2003; 102(8): 2885 - 2891.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
L. Rivoltini, C. Castelli, M. Carrabba, V. Mazzaferro, L. Pilla, V. Huber, J. Coppa, G. Gallino, C. Scheibenbogen, P. Squarcina, et al.
Human Tumor-Derived Heat Shock Protein 96 Mediates In Vitro Activation and In Vivo Expansion of Melanoma- and Colon Carcinoma-Specific T Cells
J. Immunol., October 1, 2003; 171(7): 3467 - 3474.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
J. D. Marshall, K. Fearon, C. Abbate, S. Subramanian, P. Yee, J. Gregorio, R. L. Coffman, and G. Van Nest
Identification of a novel CpG DNA class and motif that optimally stimulate B cell and plasmacytoid dendritic cell functions
J. Leukoc. Biol., June 1, 2003; 73(6): 781 - 792.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
S. Gnjatic, D. Atanackovic, M. Matsuo, E. Jager, S. Y. Lee, D. Valmori, Y.-T. Chen, G. Ritter, A. Knuth, and L. J. Old
Cross-Presentation of HLA Class I Epitopes from Exogenous NY-ESO-1 Polypeptides by Nonprofessional APCs
J. Immunol., February 1, 2003; 170(3): 1191 - 1196.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
J. Li, Y. Sun, and A. Garen
Immunization and immunotherapy for cancers involving infection by a human papillomavirus in a mouse model
PNAS, December 10, 2002; 99(25): 16232 - 16236.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow Request Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Zwaveling, S.
Right arrow Articles by Melief, C. J. M.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Zwaveling, S.
Right arrow Articles by Melief, C. J. M.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS