The JI
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     
 


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow Request Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Staats, H. F.
Right arrow Articles by Haynes, B. F.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Staats, H. F.
Right arrow Articles by Haynes, B. F.
The Journal of Immunology, 2001, 167: 5386-5394.
Copyright © 2001 by The American Association of Immunologists

Cytokine Requirements for Induction of Systemic and Mucosal CTL After Nasal Immunization1

Herman F. Staats2,*,{dagger},{ddagger},§, Curtis P. Bradney*, William M. Gwinn{ddagger}, Shawn S. Jackson||, Gregory D. Sempowski*,§, Hua-Xin Liao*,§, Norman L. Letvin|| and Barton F. Haynes*,§

Departments of * Medicine, {dagger} Immunology, and {ddagger} Pathology, § Human Vaccine Institute, and Center For AIDS Research, Duke University Medical Center, Durham, NC 27710; and || Harvard Medical School, and Division of Viral Pathogenesis, Department of Medicine, Beth Israel Deaconess Medical Center, Boston, MA 02215


    Abstract
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Cholera toxin (CT) is frequently used as an experimental adjuvant intranasally for the induction of systemic and mucosal immunity. However, CT is highly reactogenic and not approved for use in humans. To define the cytokine requirements for the nasal activation of the systemic and mucosal immune system, and to design new adjuvants with efficacy similar to CT, we defined the cytokines that were able to replace CT as a nasal adjuvant for the induction of CTL. BALB/c mice were nasally immunized with an HIV immunogen that contains an MHC class I-restricted CTL epitope ± cytokines and tested for HIV-specific immune responses. We found that combinations of IL-1{alpha} plus IL-18, IL-1{alpha} plus IL-12, and IL-1{alpha} plus IL-12 plus GM-CSF each induced optimal splenocyte anti-HIV CTL responses in immunized mice (range 60–71% peptide-specific 51Cr release). Peak H-2Dd-peptide tetramer-binding T cell responses induced by cytokine combinations were up to 5.5% of CD8+ PBMC. Nasal immunization with HIV immunogen and IL-1{alpha}, IL-12, and GM-CSF also induced Ag-specific IFN-{gamma}-secreting cells in the draining cervical lymph node and the lung. The use of IL-1{alpha}, IL-12, and GM-CSF as nasal adjuvants was associated with an increased expression of MHC class II and B7.1 on nonlymphocytes within the nasal-associated lymphoid tissue/nasal mucosa. Thus, IL-1{alpha}, IL-12, IL-18, and GM-CSF are critical cytokines for the induction of systemic and mucosal CTL after nasal immunization. Moreover, these cytokines may serve as effective adjuvants for nasal vaccine delivery.


    Introduction
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Nasal immunization has the potential to induce a wide variety of Ag-specific immune responses, from Ag-specific mucosal tolerance to Ag-specific systemic and mucosal cell-mediated and humoral immune responses. The types of immune responses induced after nasal immunization are greatly affected by the use of adjuvants. The most widely studied nasal adjuvant is cholera toxin (CT).3 CT stimulates the production of the proinflammatory cytokines IL-1 and IL-6 by mucosal epithelial cells (1, 2), up-regulates the expression of the costimulatory molecule B7.2 on mucosal APCs (3), enhances the production of IL-1 and Ag-presenting activity by macrophages (4), and increases the permeability of the epithelium (5). These observations support the hypothesis that CT exhibits nasal adjuvant activity due to its ability to induce the production of proinflammatory cytokines at the inductive site of the nasal immune system, which create a microenvironment able to sustain the induction of Ag-specific, humoral, and cell-mediated immune responses.

Ags delivered via a nasal route first make contact with epithelial cells. IL-1, IL-12, IL-18, GM-CSF, and IFN-{gamma} have all been implicated in a cytokine pathway involved with the induction of MHC class I-restricted CTL via production of IL-1{alpha} by the mucosal epithelium (1) and APCs (6), followed by release of IL-18 (7). Both IL-1 and IL-18 are produced by mucosal epithelial cells (1, 8, 9, 10). IL-1 induces the production of IL-12 and GM-CSF by resident macrophages and IFN-{gamma} by local NK and T cells (11). IL-18 and IL-12 synergistically induce the production of IFN-{gamma} by local NK cells (7). IFN-{gamma} enhances presentation of MHC class I-restricted Ags (12, 13). T cells responding to specific Ag produce GM-CSF that activates macrophages and dendritic cells to enhance APC activity (14, 15).

We recently reported that IL-1{alpha} and IL-1{beta} exhibit mucosal adjuvant activity for the induction of serum IgG and mucosal IgA Ab responses when nasally administered with soluble protein Ags (16). Although IL-1{alpha} and IL-1{beta} could support the induction of humoral immunity after nasal immunization with soluble protein Ags, the induction of CTL after nasal immunization was not studied. Because CT is not approved for use in humans, it would be advantageous to replace CT as an adjuvant and to develop an adjuvant combination of cytokines that maximally activated host immunity via nasal immunization. Moreover, in doing so, we would define the cytokine requirements for CTL induction via the nasal route. Therefore, we have evaluated proinflammatory and immunoregulatory cytokines for their ability to induce Ag-specific CTL after nasal immunization with a model soluble protein HIV immunogen.


    Materials and Methods
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Animals

Female BALB/c mice, 16–18 g, were purchased from Frederick Cancer Research and Developmental Center, National Cancer Institute (Frederick, MD). Animals were housed in filter top cages and provided food and water ad libitum. Procedures for use and care of mice were approved by Duke University’s Institutional Animal Care and Use Committee.

Immunization

Mice were intranasally (i.n.) immunized, as previously described (16, 17, 18). Briefly, mice (three to five mice per group) were immunized i.n. with the indicated amount of HIV immunogen and the indicated adjuvant in a total volume of 15 µl sterile distilled water (7.5 µl/nostril), while mice were under isoflurane anesthesia (IsoFlo, USP; SOLVAY Animal Health, Mendota Heights, MN). The mucosal adjuvant CT was obtained from List Biological Laboratories (Campbell, CA). Recombinant murine cytokines were purchased from PeproTech (Rocky Hill, NJ), BioSource International (Camarillo, CA), or Chemicon (Temecula, CA).

HIV synthetic peptides

Synthetic HIV peptides C4-V3IIIB and C4-V3MN were used as HIV immunogens (17, 19, 20, 21). The amino acid sequence for C4-V3IIIB is KQIINMWQEVGKAMYATRPNNNTRKSIRIQRGPGRAFVTI. The amino acid sequence for C4-V3MN is KQIINMWQEVGKAMYATRPNYNKRKRIHIGPGRAFYTTK. Smaller synthetic peptides from the gp120 V3 loop of HIV-1IIIB (RGPGRAFVTI) and HIV-1MN (RIHIGPGRAFYTTKN) containing the H-2Dd-restricted CTL epitopes were used for in vitro restimulation of CTL effector cells, labeling of CTL target cells, and antigenic stimulation of splenocytes in the IFN-{gamma} ELISPOT assay. Peptides used for immunization of mice were purchased from SynPep (Dublin, CA) and purified to a single species by HPLC and verified by mass spectroscopy. Peptides used for in vitro assays were purchased from SYNPEP as HPLC-purified peptides with >80% purity. Peptide mass was verified by mass spectroscopy.

CTL assay

Restimulation of effector cells. BALB/c splenocytes were removed, purified by lymphocyte separation medium (ICN Biomedicals, Aurora, OH), and used as effector cells to monitor HIV-specific CTL responses. Splenocytes were resuspended in CTL media (RPMI 1640, 10% FBS, HEPES, penicillin/streptomycin, nonessential amino acids, essential amino acids, 2-ME, 2 ml 2 N NaOH, sodium pyruvate) at a cell density of 1 x 107 cells/ml. Effector cells were added to wells in a 24-well plate (750 µl/well), followed by the addition of 1 ml CTL media containing the appropriate CTL epitope peptide at 1.75 µg/ml to each well to give a final peptide concentration of 1 µg/ml. Splenocytes from naive mice were also restimulated to determine whether in vitro restimulation induced peptide-specific CTL. Cells were incubated in 10% CO2, at 37°C. On day 2 or 3, 500 µl CTL media containing murine rIL-2 (at 45 U/ml) were added to each well of CTL effector cells to give a final concentration of 10 U/ml murine rIL-2. Effector cells were tested in a chromium release assay after restimulation for 7 days.

Chromium release assay. A standard chromium release assay was used to monitor CTL activity. Briefly, target cells were pulsed with 100 µCi/ml 51Cr ± 40 µg/ml CTL epitope peptide for 3–4 h before use in the 4-h chromium release assay. Percent specific lysis was calculated as follows: ((experimental cpm - spontaneous cpm)/(maximum cpm - spontaneous cpm)) x 100. Results are presented as peptide-specific lysis, calculated by subtracting the percent specific lysis of control target cells from the percent specific lysis of the peptide-pulsed target cells at the same E:T ratio.

IFN-{gamma} ELISPOT

Millipore MAHA S45 96-well multiscreen plates were coated with 50 µl/well anti-mouse IFN-{gamma} capture Ab (catalog 18180D; BD PharMingen, San Diego, CA) diluted to 5 µg/ml in sterile PBS. Plates were incubated overnight at 4°C or 3 h at 37°C. After incubation, plates were washed three times with sterile PBS, 100 µl/well, and then blocked with CTL media, 100 µl/well for at least 30 min. Blocking media were removed, and 100 µl cells ± Ag (CTL epitope peptide at 1 µg/ml final concentration) were added to appropriate wells. Cells were added at concentrations to give 5 x 105, 2.5 x 105, and 1.25 x 105 cells/well. Plates were incubated at 37°C, 10% CO2 in air, humidified atmosphere for 36–48 h. After incubation, plates were washed three times with 100 µl PBS, followed by three times with 100 µl PBS-Tween. Anti-IFN-{gamma} detection Ab (BD PharMingen; 18112D) was diluted to 5 µg/ml in PBS-10% FBS, and 50 µl well was added to each well and incubated at room temperature for 3 h. After incubation, plates were washed six times with PBS-Tween, and streptavidin-HRP (BD PharMingen; 3047E) diluted 1/500 in PBS-10% FBS was added to each well (50 µl/well) and incubated at room temperature for 1 h. After incubation, plates were washed six times with PBS-Tween and developed with 100 µl/well 3-amino-9-ethylcarbazole substrate (according to manufacturer’s instructions; Pierce Chemical, Rockford, IL) at room temperature for up to 1 h. The reaction was stopped by rinsing plate in tap water. The plastic support from back of 96-well filter plates was removed and plates were air dried overnight before spots were counted with a Leica (Deerfield, IL) StereoZoom 5 microscope with fiber optic ring lamp. The frequency of peptide-specific IFN-{gamma} producing cells per 106 cells was calculated by subtracting the number of IFN-{gamma} spot-forming cells (SFC)/106 detected in the absence of CTL peptide stimulation from the number of IFN-{gamma} SFC/106 detected in the presence of CTL peptide stimulation.

MHC class I-peptide tetramer-binding assay; tetrameric H-2Dd/p18 complex formation

A pET-3d vector containing DNA coding for the soluble domain of H-2Dd with a 3' BirA substrate peptide, generated as described by Altman et al. (22) and Kuroda et al. (23), was kindly provided by C. Bergmann (University of Southern California, Los Angeles, CA) for tetramer production. Inclusion bodies containing H-2Dd chains were prepared from isopropyl-1-thio-{beta}-D-galactopyranoside-stimulated cultures of the BL21(DE3)pLysS strain of Escherichia coli (Stratagene, La Jolla, CA) by repeated sonication in 40 mM Tris (pH 8), 10 mM EDTA, 0.2 M NaCl, 0.1 mM PMSF, 10 mM DTT, and 0.5% Triton X-100. Human {beta}2-microglobulin ({beta}2m) was similarly expressed in cultures of XA90 E. coli. The inclusion body preparations were dissolved in 6 M guanidine-HCl, 20 mM HEPES, 10 mM EDTA, and 10 mM DTT.

The H-2Dd-restricted p18 peptide, a 10-aa fragment of HIV-1 IIIB Env (aa 318–327), was used to induce folding of the H-2Dd MHC class I molecule and {beta}2m. Folding was initiated by diluting the subunits to 4–5 µM {beta}2m and 1–2 µM Dd in a buffer containing 20 µM p18 and comprised of 400 mM L-arginine-HCl, 100 mM Tris (pH 8.3), 2 mM EDTA, 0.5 mM oxidized glutathione, 5 mM reduced glutathione, and 0.2 mM PMSF. After incubation for 2 days at 4°C, the folded H-2Dd/p18 monomers were purified on a MonoQ column (Pharmacia, Piscataway, NJ) in 20 mM Tris (pH 8) with a gradient of NaCl from 0 to 0.5 M. Purified H-2Dd monomers were biotinylated with BirA enzyme (Avidity, Denver, CO), following the manufacturer’s instructions (efficiency of biotinylation, 80–95%). Free biotin was removed from the monomers via a Superdex 200 HR 10/30 gel filtration column (Pharmacia). Monomers were stored in PBS (pH 8) containing 15 µg/ml benzamidine HCl, 10 µg/ml phenanthroline, 10 µg/ml aprotinin, 10 µg/ml leupeptin, 10 µg/ml pepstatin A, 1 mM PMSF, and 0.01% NaN3. Tetramers were generated by mixing PE-labeled streptavidin (Prozyme, San Leandro, CA) at a 4:1 molar ratio and stored with protease inhibitors, as above.

Staining and phenotypic analysis of p18-specific CD8+ T cells

A total of 0.1–0.2 µg PE-labeled tetrameric complex was used in conjunction with anti-CD8{alpha} (clone 53-6.7; BD PharMingen) conjugated to PerCP to stain 100 µl blood processed, as indicated below. Peripheral blood samples were diluted in RPMI (40 U/ml sodium heparin). Samples were washed with RPMI and lysed in 144 mM NH4Cl, 17 mM Tris buffer (pH 7.2). The samples were resuspended (to 100 µl/sample) for staining in PBS/2% FCS. Samples were incubated with the tetrameric complexes, followed by incubation with anti-CD8{alpha} (15 min at room temperature). Cells were washed with PBS/2% FCS, resuspended in 0.5 ml PBS containing 1.5% paraformaldehyde, and analyzed on a BD Biosciences (Mountain View, CA) FACSCalibur.

Isolation of lung cells

Cells within the circulatory system of the lung were removed by injecting digestion media (RPMI 1640, 5% FBS, HEPES, penicillin/streptomycin, 2.5 mg/ml collagenase A; Roche Molecular Biochemical 1088 785, Indianapolis, IN) and 34 U/ml DNase I, grade II (Roche Molecular Biochemical 104 159) into the right ventricle of the heart until the lung became white. The lung was then removed and placed in digestion media and minced into small pieces (<2 mm2) using scissors. Lung tissue was then placed in a 50-ml Erlenmeyer flask with 25 ml digestion media and a stir bar and placed on a magnetic stirrer housed in an incubator at 37°C and 5% CO2. The lung tissue was digested for up to 2 h and then filtered through a 40-µm cell strainer (catalog 35-2340; Falcon, Franklin Lakes, NJ). Isolated lung cells were pelleted, resuspended in 10 ml room temperature 44% Percoll (Amersham Pharmacia Biotech, Piscataway, NJ), and then layered over 10 ml lymphocyte separation media (ICN Biomedicals) in a 50-ml centrifuge tube and centrifuged for 20 min at 1800 rpm. Cells at the Percoll-lymphocyte separation media interface were collected, washed, and used in the IFN-{gamma} ELISPOT assay.

Phenotypic characterization of nasal-associated lymphoid tissue (NALT) and nasal mucosa cells using flow cytometry

Cells were harvested from the NALT and nasal mucosa as follows. The skin was removed from the head, and the lower jaw was removed. Scissors were used to cut the skull behind the eyes, removing the posterior portion of the snout from the rest of the skull. The bony skull was then cut from the opening of each nostril to the eye socket on each side of the skull. The nasal septum was cut, and the top portion of the skull was removed, leaving the palate and associated nasal tissues. Scissors were used to make a cross section cut to remove the upper incisors. Cells in the NALT and nasal mucosa area were removed by mechanically scraping the area immediately above the soft palate that contains the NALT structures (24). Cells from five mice per group were pooled in media (RPMI 1640, 5% FBS). Cells were filtered using a 40-µm cell strainer (Falcon; catalog 35-2340). RBC were removed using ammonium chloride lysis buffer. NALT/nasal mucosa cells were then washed, incubated on ice with unlabeled mouse IgG2a (10 µg/106; Southern Biotechnology Associates, Birmingham, AL) cells to block Fc{gamma} receptors, washed, and then resuspended to 3 x 106 cells/ml. Fluorescently labeled and biotinylated mAbs (BD PharMingen) were diluted in wash buffer (PBS, 1% FBS, 0.1% Kathon), and a total volume of 50 µl containing 0.25 µg of each appropriate Ab was added per well of a 96-well round-bottom plate. A total of 150,000 cells in 50 µl media was added per well (to give a 100 µl final volume), gently mixed, and stained for 30 min at 4°C in the dark. Cells were stained with FITC anti-CD3, PE anti-pan NK, CyChrome anti-CD8, FITC anti-B220, FITC anti-CD11c, or APC anti-Gr-1. Appropriate negative (isotype) and positive controls for each fluorescent label were also included. For analysis of MHC class II, B7.1, and B7.2, cells were triple stained with FITC anti-CD3; PE anti-CD19; and either biotinylated anti-MHC class II, anti-B7.1, or anti-B7.2 for 30 min in the dark at 4°C. After washing, secondary labeling with streptavidin-APC was performed for 20 min in the dark at 4°C. Cells were washed after staining with wash buffer and resuspended in 200 µl/well fluorescent fixative (PBS, 1% formaldehyde, 0.1% Kathon). Cells were transferred to polystyrene tubes containing an additional 300 µl fluorescent fixative (0.5 ml final volume), gently mixed, and analyzed with a FACSVantage SE from BD Biosciences using CellQuest software. To distinguish between lymphocytes and nonlymphocytes, analysis of MHC class II, B7.1, and B7.2 was performed using CD3+ or CD19+ or CD3- and CD19- gated cells. All viable cells, based on forward and side scatter, were gated to include all cell populations present in the NALT/nasal mucosa.

Statistical analysis

Statistical analysis was determined using t test analysis. Because the comparison of activity between control groups (nasal immunization with peptide without adjuvant to nasal immunization with peptide plus adjuvant) was planned a priori, t tests were performed to compare each experimental group with the control group (25, 26) The level of significance used was 0.05. Error bars represent SD.


    Results
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Cytokines are able to support the induction of spleen HIV-1-specific CTL and IFN-{gamma} secretion after nasal administration with an HIV immunogen

BALB/c mice were nasally immunized with the C4-V3IIIB HIV-1 immunogen at 1, 10, or 100 µg ± cytokines on days 0, 7, 14, and 28 to identify cytokines involved with the induction of HIV-1-specific CTL. Cytokines tested included IL-1{alpha}, IL-12, IL-18, IL-12 and IL-18, and GM-CSF (Table IGo). Nasal administration of adjuvants alone or C4-V3IIIB alone induced only background levels of 51Cr release (Fig. 1Go). When 10 µg C4-V3IIIB was used as the nasal immunogen, CT was able to induce HIV-specific cell lysis that was significantly elevated compared with mice nasally immunized with 10 µg C4-V3IIIB alone (61.4 ± 2.66% vs 19.41 ± 6.95% HIV peptide-specific lysis, respectively, p = 0.0003) (Fig. 1Go). Nasal immunization with 10 µg C4-V3IIIB and CT was also the group with the absolute highest level of HIV-specific cell lysis (Fig. 1Go). Cytokines that were able to induce significant CTLresponses (p < 0.02) include IL-1{alpha}, IL-18, and IL-12 and IL-18 when nasally administered with 100 µg HIV immunogen. Nasal immunization with 100 µg C4-V3IIIB alone induced 13.67 ± 1.7% peptide-specific lysis, while that addition of IL-1{alpha}, IL-18, or IL-12 and IL-18 increased peptide-specific lysis to 42.44 ± 14.2, 23.96 ± 5.5, and 46.29 ± 6.6% peptide-specific lysis, respectively. GM-CSF nor IL-12 alone induced significant increases in CTL lytic activity. Therefore, IL-1{alpha}, IL-18, and the combination of IL-12 and IL-18 were important for the induction of peptide-specific CTL after nasal immunization.


View this table:
[in this window]
[in a new window]
 
Table I. Adjuvant and immunogen combinations used in this study

 


View larger version (30K):
[in this window]
[in a new window]
 
FIGURE 1. Induction of peptide-specific CTL after nasal immunization with peptide immunogen in the presence of select cytokines. BALB/c mice (three mice per group) were immunized nasally on days 0, 7, 14, and 28 with 1, 10, or 100 µg C4-V3IIIB peptide alone or in combination with CT or select cytokines (Table IGo). Mice were lightly anesthetized with isoflurane before 7.5 µl vaccine formulation was instilled into each nostril. Splenocytes were isolated at day 35 and restimulated in vitro for 7 days before being used in a chromium release CTL assay. *, Statistically increased CTL activity compared with animals nasally immunized with peptide alone (p <= 0.05). Comparisons were made between groups immunized with the same dose of peptide.

 
To quantify the magnitude of the induced Ag-specific T cell population after nasal immunization, splenocytes from mice immunized i.n. with C4-V3IIIB ± adjuvants were evaluated for Ag-specific IFN-{gamma} secretion using the ELISPOT assay (Fig. 2Go). As observed with the CTL lysis, the group with the absolute highest frequency of IFN-{gamma}-secreting cells was immunized i.n. with 10 µg C4-V3IIIB and CT (Fig. 2Go). When 100 µg C4-V3IIIB was used as the immunogen, CT, IL-1{alpha}, IL-18, IL-12 and IL-18, and GM-CSF induced IFN-{gamma}-secreting cell frequencies (199.7 ± 70.2, 150.5 ± 89.5, 49.5 ± 23.4, 89 ± 51.2, and 137.7 ± 73.1 IFN-{gamma} SFC/106 splenocytes, respectively) significantly (p < 0.03) above those detected in mice immunized with 100 µg C4-V3IIIB only (13.67 ± 4.5 IFN-{gamma} SFC/106 splenocytes). Thus, IL-1{alpha} alone, IL-18 alone, IL-12 and IL-18 in combination, and GM-CSF alone were important for nasal induction of Ag-specific IFN-{gamma}-secreting cells.



View larger version (24K):
[in this window]
[in a new window]
 
FIGURE 2. Induction of peptide-specific IFN-{gamma} SFC after nasal immunization with peptide immunogen in the presence of select cytokines. BALB/c mice (three mice per group) were immunized nasally on days 0, 7, 14, and 28 with 1, 10, or 100 µg C4-V3IIIB peptide alone or in combination with CT or select cytokines (Table IGo). Mice were lightly anesthetized with isoflurane before 7.5 µl vaccine formulation was instilled into each nostril. Splenocytes were isolated at day 35 and used in an IFN-{gamma} ELISPOT assay. *, Statistically increased frequency of IFN-{gamma}-producing cells compared with animals nasally immunized with peptide alone (p <= 0.05). Comparisons were made between groups immunized with the same dose of peptide.

 
More complex combinations of cytokines support induction of peptide-specific CTL, IFN-{gamma}-producing T cells, and H-2Dd-peptide tetramer-positive CD8+ T cells comparable with CT

Next, more complex combinations of cytokines were tested for their ability to induce HIV-specific CTL, IFN-{gamma} secretion, and tetramer binding comparable with those induced with the use of CT. Because the highest level of Ag-specific CTL activity and IFN-{gamma} secretion was detected after i.n. immunization with 10 µg C4-V3IIIB and CT (Figs. 1Go and 2Go), the 10 µg dose of C4-V3IIIB was used for the remaining studies. Mice were immunized nasally with 10 µg C4-V3IIIB alone or in the presence of CT or cytokine combinations. As previously observed, nasal immunization with 10 µg C4-V3IIIB and CT induced CTL lytic activity (40.96 ± 0.48% peptide-specific lysis) that was significantly increased compared with the CTL activity detected in naive animals or animals immunized with C4-V3IIIB alone (14.62 ± 2.72% and 15.18 ± 0.37% peptide-specific lysis, respectively, p < 0.00001) (Fig. 3Go). Cytokine combinations that induced CTL lytic activities that were significantly increased compared with immunization with C4-V3IIIB alone included IL-1{alpha} plus IL-18 (p < 0.00001), GM-CSF plus IL-12 plus IL-18 (p < 0.05), IL-1{alpha} plus GM-CSF (p < 0.001), IL-1{alpha} plus IL-12 (p < 0.00001), IL-1{alpha} plus IL-18 (p < 0.00001), IL-1{alpha} plus IL-12 plus IL-18 plus GM-CSF (p < 0.0002), and IL-1{alpha} plus IL-12 plus GM-CSF (p < 0.0006) (Fig. 3Go). Importantly, the combinations of IL-1{alpha} plus GM-CSF, IL-1{alpha} plus IL-12, IL-1{alpha} plus IL-18, IL-1{alpha} plus IL-12 plus GM-CSF, and IL-1{alpha} plus IL-12 plus IL-18 plus GM-CSF induced the highest CTL lytic activities (59.55 ± 10.5, 59.6 ± 3.7, 64.33 ± 5.2, 71.66 ± 11.7, 67.01 ± 7.1% peptide-specific lysis, respectively) that were all significantly increased compared with that induced by nasal immunization with C4-V3IIIB and CT (p < 0.02) (Fig. 3Go).



View larger version (38K):
[in this window]
[in a new window]
 
FIGURE 3. Induction of peptide-specific CTL after nasal immunization with peptide immunogen in the presence of cytokine(s). BALB/c mice (three to four mice per group) were immunized nasally on days 0, 7, 14, and 28 with 10 µgC4-V3IIIB peptide alone or in combination with CT or select cytokines (Table IGo). Mice were boosted on day 42 with 10 µg peptide only. Mice were lightly anesthetized with isoflurane before 7.5 µl vaccine formulation was instilled into each nostril. Splenocytes were isolated at day 51 and restimulated in vitro for 7 days before being used in a chromium release CTL assay. *, Statistically increased CTL activity compared with animals nasally immunized with peptide alone (p <= 0.05). #, Statistically increased CTL activity compared with animals nasally immunized with peptide and CT (p <= 0.05).

 
The frequency of Ag-specific IFN-{gamma}-secreting cells in splenocytes after nasal immunization with immunogen and complex cytokine combinations was next determined using the ELISPOT technique. Nasal immunization with C4-V3IIIB and CT induced 152.6 ± 20.9 IFN-{gamma}-secreting cells/106 splenocytes, while nasal immunization with C4-V3IIIB only induced 3.66 ± 6.35 IFN-{gamma}-secreting cells/106 splenocytes. Significant increases in peptide-specific IFN-{gamma} secretion were observed in all groups, except GM-CSF and IL-12 used alone (p < 0.05) (Fig. 4Go). The frequency of peptide-specific IFN-{gamma}-secreting splenocytes was greater than 200/106 splenocytes when IL-1{alpha} plus IL-18, IL-1{alpha} plus IL-12 plus GM-CSF, IL-1{alpha} plus IL-18 plus GM-CSF, and IL-1{alpha} plus IL-12 plus IL-18 plus GM-CSF were used as adjuvants (236 ± 117, 209 ± 46, 227 ± 107, and 231 ± 68 IFN-{gamma} SFC/106 splenocytes, respectively) (Fig. 4Go).



View larger version (33K):
[in this window]
[in a new window]
 
FIGURE 4. Induction of peptide-specific IFN-{gamma} SFC after nasal immunization with peptide immunogen in the presence of cytokine(s). BALB/c mice (three to four mice per group) were immunized nasally on days 0, 7, 14, and 28 with 10 µg C4-V3IIIB peptide alone or in combination with CT or select cytokines (Table IGo). Mice were boosted on day 42 with 10 µg peptide only. Mice were lightly anesthetized with isoflurane before 7.5 µl vaccine formulation was instilled into each nostril. Splenocytes were isolated at day 51 and used in an IFN-{gamma} ELISPOT assay. *, Statistically increased frequency of IFN-{gamma}-producing cells compared with animals nasally immunized with peptide alone (p <= 0.05). No groups were significantly increased compared with animals immunized with CT and peptide.

 
H-2Dd-HIV peptide tetramers were used in flow cytometric assays to identify the percentage of CD8+ cells in the peripheral blood that were specific for the HIV envelope V3 P18 HIV CTL epitope that was in our model HIV immunogen. The percentage of tetramer-positive cells in the CD8+ population of the peripheral blood of animals immunized with peptide alone was not increased over the percentage of tetramer-positive cells detected in naive mice (0.3 ± 0.14% and 0.45 ± 0.31%, respectively; n = 3) (Fig. 5Go). The use of CT as an adjuvant significantly increased the percentage of tetramer+ cells to 2.9 ± 0.7% of the CD8+ PBMC (p < 0.002 compared with tetramer+ cells in mice immunized with peptide alone). Cytokines and cytokine combinations that significantly increased the percentage of tetramer+ cells in the CD8+ PBMC pool include IL-1{alpha} (p < 0.0004), GM-CSF (p < 0.02), IL-12 plus IL-18 (p < 0.02), GM-CSF plus IL-12 plus IL-18 (p < 0.004), IL-1{alpha} plus GM-CSF (p < 0.004), IL-1{alpha} plus IL-12 (p < 0.02), IL-1{alpha} plus IL-18 (p < 0.0002), IL-1{alpha} plus IL-12 plus GM-CSF (p < 0.02), IL-1{alpha} plus IL-18 plus GM-CSF (p < 0.0006), and IL-1{alpha} plus IL-12 plus IL-18 plus GM-CSF (p < 0.0004) (Fig. 5Go). The combination of IL-1{alpha} plus IL-18 induced the absolute highest percentage of tetramer+ cells in the CD8+ PBMC pool with 5.52 ± 0.71%. The percentage of tetramer+ cells induced by IL-1{alpha} plus IL-18 was significantly increased compared with the percentage of tetramer+ cells induced by CT (p < 0.006).



View larger version (31K):
[in this window]
[in a new window]
 
FIGURE 5. Induction of MHC class I-peptide tetramer-binding CD8+ PBMC after nasal immunization with peptide immunogen in the presence of cytokine(s). BALB/c mice (three to four mice per group) were immunized nasally on days 0, 7, 14, and 28 with 10 µg C4-V3IIIB peptide alone or in combination with CT or select cytokines (Table IGo). Mice were boosted on day 42 with 10 µg peptide only. Mice were lightly anesthetized with isoflurane before 7.5 µl vaccine formulation was instilled into each nostril. PBMC were isolated at day 51 and stained for the presence of CD8 and tetramer-binding cells using flow cytometry. *, Statistically increased frequency of tetramer-binding cells compared with animals nasally immunized with peptide alone (p <= 0.05). No groups were significantly increased compared with animals immunized with CT and peptide.

 
To determine the reproducibility of the adjuvant effect of nasal cytokine combinations, BALB/c mice were immunized nasally with the C4-V3MN immunogen, a model HIV immunogen designed from a second HIV strain, HIV-1 MN. Nasal immunization with peptide alone did not induce CTL lytic activity that was greater than that observed in naive mice (Fig. 6Go). When nasally administered with the C4-V3MN immunogen, CT and all other cytokines or cytokine combinations tested induced Ag-specific CTL lytic responses that were significantly increased compared with responses induced by nasal immunization with C4-V3MN alone (p < 0.03). The highest level of Ag-specific CTL activity induced by nasal immunization with C4-V3MN was in the presence of IL-{alpha} plus IL-12 plus IL-18 plus GM-CSF with 41.47 ± 9.53% Ag-specific lysis when tested at a 20:1 E:T ratio (Fig. 6Go). IL-1{alpha} plus IL-12 plus GM-CSF and CT induced 35.12 ± 7.9% and 32.07 ± 3.44% specific release, respectively, at 20:1 E:T ratio.



View larger version (40K):
[in this window]
[in a new window]
 
FIGURE 6. Induction of peptide-specific CTL after nasal immunization with peptide immunogen in the presence of cytokine(s). BALB/c mice (three to four mice per group) were immunized nasally on days 0, 7, 14, and 28 with 10 µg C4-V3MN peptide alone or in combination with CT or select cytokines (Table IGo). Mice were boosted on day 42 with 10 µg peptide only. Mice were lightly anesthetized with isoflurane before 7.5 µl vaccine formulation was instilled into each nostril. Splenocytes were isolated at day 51 and restimulated in vitro for 7 days before being used in a chromium release CTL assay. *, Statistically increased CTL activity compared with animals nasally immunized with peptide alone (p <= 0.05).

 
Nasal immunization with HIV immunogen and cytokine adjuvants induces HIV-specific IFN-{gamma}-secreting cells in systemic and mucosal tissues

The induction of HIV-specific cell-mediated immunity at mucosal surfaces may be important for vaccine-induced protection against mucosal transmission of HIV. We therefore determined whether nasal immunization with HIV immunogen and the cytokine adjuvant combination of IL-1{alpha}, IL-12, and GM-CSF induced HIV-specific IFN-{gamma}-secreting cells in the draining cervical lymph node (the lymph node that drains the NALT), spleen, and lung (as a representative mucosal tissue). Nasal immunization with 10 µg C4-V3IIB and IL-1{alpha}, IL-12, and GM-CSF induced 311 ± 56.7, 356 ± 50.9, and 318 ± 145.2 HIV-specific IFN-{gamma} SFC/106 cells in the cervical lymph node, spleen, and lung, respectively (p <= 0.01 vs peptide only; Fig. 7Go). Nasal immunization with peptide alone induced IFN-{gamma} SFC responses less than three IFN-{gamma} SFC/106 cells, while naive mice had no detectable HIV-specific IFN-{gamma} SFC responses in any tissue (Fig. 7Go).



View larger version (18K):
[in this window]
[in a new window]
 
FIGURE 7. Induction of peptide-specific IFN-{gamma} SFC in systemic and mucosal tissues after nasal immunization with peptide immunogen in the presence of IL-1{alpha}, IL-12, and GM-CSF. BALB/c mice (15 mice per group) were immunized nasally on days 0, 7, 14, and 28 with 10 µg C4-V3IIIB peptide alone or in combination with IL-1{alpha}, IL-12, and GM-CSF (Table IGo). Mice were lightly anesthetized with isoflurane before 7.5 µl vaccine formulation was instilled into each nostril. Splenocytes, cervical lymph nodes, and lung cells were isolated from five mice/group on days 34, 35, and 36, pooled, and used in an IFN-{gamma} ELISPOT assay. *, Statistically increased frequency of IFN-{gamma}-producing cells compared with animals nasally immunized with peptide alone or naive animals (p <= 0.05).

 
Nasal immunization with HIV immunogen and cytokine adjuvants is associated with an increase in CD3+ cells and increased expression of MHC class II and B7.1 in NALT/nasal mucosal cells

To determine whether there was an association between 1) the use of cytokines as mucosal adjuvants, 2) the induction of HIV-specific IFN-{gamma} SFC responses, and 3) changes in the cellular populations within the NALT/nasal mucosal, cells were isolated from the NALT/nasal mucosa of mice used in the experiment for Fig. 7Go and analyzed via flow cytometry for the expression of CD3, B220, DX5 (pan-NK), CD11c, Gr-1, MHC class II, B7.1, and B7.2 (Table IIGo). Mice immunized with HIV immunogen plus IL-1{alpha}, IL-12, and GM-CSF had 34.25 ± 2.77% CD3+ cells in the NALT/nasal mucosal, while mice immunized with HIV immunogen had 21.4 ± 3.62% CD3+ cells (p <= 0.05). The use of IL-1{alpha}, IL-12, and GM-CSF was also associated with a significant decrease in B220+ cells since mice immunized with immunogen only had 29.5 ± 2.79% B220+ cells, while mice immunized with immunogen and IL-1{alpha}, IL-12, and GM-CSF had 20.38 ± 1.88% B220+ cells (p <= 0.05).


View this table:
[in this window]
[in a new window]
 
Table II. Phenotype of NALT/nasal mucosa cells after nasal immunization with C4-V3IIIB ± cytokine adjuvants1

 
The lymphocyte (CD3+ or CD19+) and nonlymphocyte (CD3- and CD19-) populations were also analyzed for the expression of MHC class II, B7.1, and B7.2 to determine whether up-regulation of molecules associated with Ag presentation and costimulation was associated with the use of IL-1{alpha}, IL-12, and GM-CSF as mucosal adjuvants. The use of IL-1{alpha}, IL-12, and GM-CSF was associated with an increase in both the percentage of positive cells and the mean fluorescence intensity (MFI) of cells in the nonlymphocyte gate when assayed for reactivity with Abs to MHC class II, B7.1, and B7.2, although only the changes in MHC class II and B7.1 were statistically significant (Table IIGo). No changes in MHC class II, B7.1, or B7.2 expression were detected in the lymphocyte population (data not shown). The percentage of nonlymphocytes expressing MHC class II increased from 12.97 ± 3.26% to 29.52 ± 3.44% when IL-1{alpha}, IL-12, and GM-CSF were used as a mucosal adjuvant (p <= 0.05). The MFI for MHC class II staining on nonlymphocytes increased from 74.02 ± 30.97 to 205.36 ± 39.85 with the use of IL-1{alpha}, IL-12, and GM-CSF (p <= 0.05). The number of nonlymphocytes expressing B7.1+ also increased from 7.89 ± 3.90% to 13.22 ± 1.87% with the use of IL-1{alpha}, IL-12, and GM-CSF (p = 0.05). The MFI for B7.1 expression on nonlymphocytes increased from 6.17 ± 5.30 to 13.6 ± 2.93 when IL-1{alpha}, IL-12, and GM-CSF were used as a mucosal adjuvant (p = 0.05).


    Discussion
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
In this study, we report that combinations of cytokines such as IL-1{alpha} plus IL-12 plus GM-CSF and IL-1{alpha} plus IL-18 were able to substitute for CT as a nasal adjuvant when administered with a model HIV immunogen and support the induction of Ag-specific CTL, IFN-{gamma}-producing cells, and H-2Dd-tetramer-binding, CD8+ peripheral blood T cells. Importantly, nasal immunization with immunogen and combinations of IL-1{alpha} plus GM-CSF, IL-1{alpha} plus IL-12, IL-1{alpha} plus IL-18, IL-1{alpha} plus IL-12 plus GM-CSF, or IL-1{alpha} plus IL-12 plus IL-18 plus GM-CSF induced CTL responses that were significantly greater than those induced by nasal immunization with peptide and CT.

Nasal immunization with Ag alone may induce Ag-specific mucosal tolerance (27, 28, 29), while nasal immunization with Ag and adjuvant has the potential to induce Ag-specific responses, including systemic and mucosal IgG and IgA and systemic CTL (16, 17, 30). Adjuvants induce cytokine production and release at the site of immunization that play a crucial role in the induction of Ag-specific immune responses. Mucosal epithelial cells are able to produce numerous cytokines that may be involved with the induction and regulation of immunity, including IL-1, IL-6, IL-18, and IL-8 (31, 32, 33, 34, 35). Mucosal epithelial cells are also responsive to local cytokine expression since they express receptors IL-1, IL-6, and GM-CSF (36, 37).

To our knowledge, this is the first report of the ability of cytokines alone to induce CTL after mucosal immunization with Ag. The cytokines GM-CSF and IL-12 have been reported to augment CTL induction after intrarectal immunization of mice with an HIV peptide immunogen when CT was used as an adjuvant (38). We previously determined that IL-1{alpha} and IL-1{beta} were able to support the induction of Ag-specific serum IgG and mucosal IgA as well as CT after nasal immunization of mice (16). Others have reported that lymphotactin was able to support the induction of Ag-specific humoral and Th responses after nasal administration with the protein Ag OVA (39). IL-12 has also been reported to have adjuvant activity for the induction of humoral and Th responses when nasally administered with Ag (40, 41). However, in these studies, IL-12 was formulated with liposomes and administered on days 0, 3, 7, 10, 14, and 17, while Ag was administered on days 0, 7, and 14. In our present study, cytokines were formulated with Ag in distilled water and coadministered at the same time.

Some cytokines evaluated in our study were active when delivered i.n., while others were not. For example, IL-1, IL-18, and GM-CSF exhibit activity for the induction of CTL when delivered i.n. with 100 µg C4-V3IIIB HIV immunogen, while IL-12 was not. This may be explained by the finding that mucosal epithelial cells express receptors for IL-1 and GM-CSF (37, 42). Therefore, IL-1 and GM-CSF are able to bind to their specific receptors on the mucosal epithelial cells, exert their biological activity, and support the induction of CTL. A possible explanation of the lack of adjuvant activity observed with the use of IL-12 alone is that the mucosal epithelial cells may not express receptors for IL-12 (43). We found IL-12 enhanced the induction of CTL when administered with IL-1{alpha}. One possible explanation to this latter observation is that IL-1 increases the permeability of nasal mucosa and allows IL-12 to cross the mucosal epithelium and exert its biological activity in the NALT. Although others have reported that IL-12 exhibits mucosal adjuvant activity after nasal administration (as mentioned previously) (41), the use of liposomes in the IL-12 formulation along with a higher dose of IL-12 (1 µg) and more frequent administration may have permitted the IL-12 to be active when administered by the nasal route.

Others have reported that cytokines were able to regulate the immune responses induced when systemically administered with HIV immunogens similar to the immunogens used in this study (44). In this previously published study, cytokines were formulated with peptide in incomplete Seppic adjuvant (mineral oil plus mannose manoleate) and administered s.c. Subcutaneous administration of immunogen and cytokines determined that GM-CSF was the most effective single cytokine for enhancement of cellular and humoral immunity (44). Interestingly, this study also observed that IL-1{beta} significantly suppressed the CTL response (44). The difference between this published study and our current study is likely to be associated with the formulation of the Ag-cytokine mixtures and the route of immunization.

Nasal immunization with HIV immunogen and IL-1{alpha}, IL-12, and GM-CSF was associated with increased expression of MHC class II and B7.1 and B7.2 on nonlymphocytes within the NALT, although only the increase for MHC class II and B7.1 expression was statistically significant. Others have also reported that up-regulation of costimulatory molecules was observed when CT or mutant CT was used as a mucosal adjuvant (3, 45). When used to stimulate C57BL/6 T-depleted Peyer’s patch (PP) cells in vitro, mutant CT enhanced the expression of B7.2 and B7.1 on B220+ and Mac-1+ cells (45). Stimulation of C57BL/6 M-CSF-generated or GM-CSF-activated bone marrow macrophages with CT was associated with an increased expression of B7.2, but not B7.1 (3). Gastric inoculation of C57BL/6 mice with 10 µg CT was associated with up-regulation of B7.2 expression on both Mac-1+ and CD11c+ cells isolated from the PP 24 h after the single CT treatment; the increase was statistically significant for the Mac-1+ cells only (3). It is not obvious why we observed significant up-regulation of B7.1 while others report a predominant up-regulation of B7.2. A difference between our experiment and the previously published work is that we used BALB/c mice, while the others used C57BL/6 mice. We also isolated cells from the NALT/nasal mucosal after nasal immunization, while the others utilized bone marrow macrophages or PP cells and gastric inoculation for their studies. We analyzed expression of costimulatory molecules with NALT/nasal mucosal cells isolated after four nasal immunizations with HIV immunogen and cytokine adjuvants, while others evaluated costimulatory molecule expression 24 h after intragastric inoculation or in vitro stimulation with CT or mutant CT, respectively (3, 45). It has been reported that B7.1 is more efficient than B7.2 for the induction of CD8+ T cell-mediated immune responses (46, 47, 48). Our vaccination regimen utilized an immunogen-adjuvant formulation that induced MHC class I-restricted, CD8+-mediated IFN-{gamma} production and CTL. Therefore, it is possible that repeated immunization with the HIV immunogen and adjuvant formulation preferentially up-regulated expression of B7.1 for the induction of CD8+-mediated immunity.

Thus, our study has demonstrated that cytokine combinations containing IL-1{alpha}, IL-12, IL-18, and/or GM-CSF could substitute completely for CT as a nasal adjuvant. It is important to note that up to 30 µg IL-1{beta} administered i.n. to rabbits did not induce a febrile response (49). Thus, combinations of these cytokines are prime candidates for use as adjuvants with HIV and other vaccines.


    Acknowledgments
 
We thank Catherine R. Doil for excellent technical assistance. We also acknowledge Dr. John F. Whitesides and Patrice M. McDermott of the Duke University Human Vaccine Institute and Department of Medicine Flow Cytometry Facility for excellent technical assistance with the flow cytometry.


    Footnotes
 
1 This work was supported by National Institutes of Health/National Institute of Allergy and Infectious Diseases Grant 2P01 AI35351 and the Research Center on HIV and AIDS, Durham Veterans Administration Hospital. C.P.B. was supported by the Interdisciplinary Training Program on AIDS, Division of Infectious Diseases, Duke University Medical Center. Back

2 Address correspondence and reprint requests to Dr. Herman F. Staats, Department of Medicine, Duke University Medical Center, Box 3307, Durham, NC 27710. E-mail address: hfs{at}acpub.duke.edu Back

3 Abbreviations used in this paper: CT, cholera toxin; {beta}2m, {beta}2-microglobulin; i.n., intranasal; MFI, mean fluorescence intensity; NALT, nasal-associated lymphoid tissue; PP, Peyer’s patch; SFC, spot-forming cell. Back

Received for publication November 30, 2000. Accepted for publication August 22, 2001.


    References
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 

  1. Bromander, A. K., M. Kjerrulf, J. Holmgren, N. Lycke. 1993. Cholera toxin enhances alloantigen presentation by cultured intestinal epithelial cells. Scand. J. Immunol. 37:452.[Medline]
  2. McGee, D. W., C. O. Elson, J. R. McGhee. 1993. Enhancing effect of cholera toxin on interleukin-6 secretion by IEC-6 intestinal epithelial cells: mode of action and augmenting effect of inflammatory cytokines. Infect. Immun. 61:4637.[Abstract/Free Full Text]
  3. Cong, Y., C. T. Weaver, C. O. Elson. 1997. The mucosal adjuvanticity of cholera toxin involves enhancement of costimulatory activity by selective up-regulation of B7.2 expression. J. Immunol. 159:5301.[Abstract]
  4. Bromander, A., J. Holmgren, N. Lycke. 1991. Cholera toxin stimulates IL-1 production and enhances antigen presentation by macrophages in vitro. J. Immunol. 146:2908.[Abstract]
  5. Lycke, N., U. Karlsson, A. Sjolander, K. E. Magnusson. 1991. The adjuvant action of cholera toxin is associated with an increased intestinal permeability for luminal antigens. Scand. J. Immunol. 33:691.[Medline]
  6. Lycke, N., A. K. Bromander, L. Ekman, U. Karlsson, J. Holmgren. 1989. Cellular basis of immunomodulation by cholera toxin in vitro with possible association to the adjuvant function in vivo. J. Immunol. 142:20.[Abstract]
  7. Hunter, C. A., J. Timans, P. Pisacane, S. Menon, G. Cai, W. Walker, M. Aste-Amezaga, R. Chizzonite, J. F. Bazan, R. A. Kastelein. 1997. Comparison of the effects of interleukin-1{alpha}, interleukin-1{beta} and interferon-{gamma}-inducing factor on the production of interferon-{gamma} by natural killer. Eur. J. Immunol. 27:2787.[Medline]
  8. Pizarro, T. T., M. H. Michie, M. Bentz, J. Woraratanadharm, Jr M. F. Smith, E. Foley, C. A. Moskaluk, S. J. Bickston, F. Cominelli. 1999. IL-18, a novel immunoregulatory cytokine, is up-regulated in Crohn’s disease: expression and localization in intestinal mucosal cells. J. Immunol. 162:6829.[Abstract/Free Full Text]
  9. Takeuchi, M., T. Okura, T. Mori, K. Akita, T. Ohta, M. Ikeda, H. Ikegami, M. Kurimoto. 1999. Intracellular production of interleukin-18 in human epithelial-like cell lines is enhanced by hyperosmotic stress in vitro. Cell Tissue Res. 297:467.[Medline]
  10. Takeuchi, M., Y. Nishizaki, O. Sano, T. Ohta, M. Ikeda, M. Kurimoto. 1997. Immunohistochemical and immuno-electron-microscopic detection of interferon-{gamma}-inducing factor ("interleukin-18") in mouse intestinal epithelial cells. Cell Tissue Res. 289:499.[Medline]
  11. Dinarello, C. A.. 1996. Biologic basis for interleukin-1 in disease. Blood 87:2095.[Abstract/Free Full Text]
  12. Fruh, K., Y. Yang. 1999. Antigen presentation by MHC class I and its regulation by interferon {gamma}. Curr. Opin. Immunol. 11:76.[Medline]
  13. Tanaka, K., M. Kasahara. 1998. The MHC class I ligand-generating system: roles of immunoproteasomes and the interferon-{gamma}-inducible proteasome activator PA28. Immunol. Rev. 163:161.[Medline]
  14. Root, R. K., D. C. Dale. 1999. Granulocyte colony-stimulating factor and granulocyte-macrophage colony-stimulating factor: comparisons and potential for use in the treatment of infections in nonneutropenic patients. J. Infect. Dis. 179:S342.
  15. Storozynsky, E., J. G. Woodward, J. G. Frelinger, E. M. Lord. 1999. Interleukin-3 and granulocyte-macrophage colony-stimulating factor enhance the generation and function of dendritic cells. Immunology 97:138.[Medline]
  16. Staats, H. F., F. A. Ennis. 1999. IL-1 is an effective adjuvant for mucosal and systemic immune responses when coadministered with protein immunogens. J. Immunol. 162:6141.[Abstract/Free Full Text]
  17. Staats, H. F., W. G. Nichols, T. J. Palker. 1996. Mucosal immunity to HIV-1: systemic and vaginal antibody responses after intranasal immunization with the HIV-1 C4/V3 peptide T1SP10 MN(A). J. Immunol. 157:462.[Abstract]
  18. Staats, H. F., S. P. Montgomery, T. J. Palker. 1997. Intranasal immunization is superior to vaginal, gastric, or rectal immunization for the induction of systemic and mucosal anti-HIV antibody responses. AIDS Res. Hum. Retroviruses 13:945.[Medline]
  19. Bartlett, J. A., S. S. Wasserman, C. B. Hicks, R. T. Dodge, K. J. Weinhold, C. O. Tacket, N. Ketter, A. E. Wittek, T. J. Palker, B. F. Haynes. 1998. Safety and immunogenicity of an HLA-based HIV envelope polyvalent synthetic peptide immunogen. AIDS 12:1291.[Medline]
  20. Hart, M. K., T. J. Palker, T. J. Matthews, A. J. Langlois, N. W. Lerche, M. E. Martin, R. M. Scearce, C. McDanal, D. P. Bolognesi, B. F. Haynes. 1990. Synthetic peptides containing T and B cell epitopes from human immunodeficiency virus envelope gp120 induce anti-HIV proliferative responses and high titers of neutralizing antibodies in rhesus monkeys. J. Immunol. 145:2677.[Abstract]
  21. Hart, M. K., K. J. Weinhold, R. M. Scearce, E. M. Washburn, C. A. Clark, T. J. Palker, B. F. Haynes. 1991. Priming of anti-human immunodeficiency virus (HIV) CD8+ cytotoxic T cells in vivo by carrier-free HIV synthetic peptides. Proc. Natl. Acad. Sci. USA 88:9448.[Abstract/Free Full Text]
  22. Altman, J. D., P. A. H. Moss, P. J. R. Goulder, D. H. Barouch, M. G. McHeyzer-Williams, J. I. Bell, A. J. McMichael, M. M. Davis. 1996. Phenotypic analysis of antigen-specific T lymphocytes. Science 274:94.[Abstract/Free Full Text]
  23. Kuroda, M. J., J. E. Schmitz, D. H. Barouch, A. Craiu, T. M. Allen, A. Sette, D. L. Watkins, M. A. Forman, N. L. Letvin. 1998. Analysis of gag-specific cytotoxic T lymphocytes in simian immunodeficiency virus-infected rhesus monkeys by cell staining with a tetrameric major histocompatibility complex class I-peptide complex. J. Exp. Med. 187:1373.[Abstract/Free Full Text]
  24. Asanuma, H., A. H. Thompson, T. Iwasaki, Y. Sato, Y. Inaba, C. Aizawa, T. Kurata, S. Tamura. 1997. Isolation and characterization of mouse nasal-associated lymphoid tissue. J. Immunol. Methods 202:123.[Medline]
  25. Rosner, B.. 1994. Multisample inference. Fundamentals of Biostatistics 319. Wadsworth Publishing, New York.
  26. Sokal, R. R., F. J. Rohlf. 1995. Comparison among means: planned comparsions. Biometry 229. W. H. Freeman and Company, New York.
  27. Waldo, F. B., A. W. L. V. D. Wall Bake, J. Mestecky, S. Husby. 1994. Suppression of the immune response by nasal immunization. Clin. Immunol. Immunopathol. 72:30.[Medline]
  28. Hoyne, G. F., R. E. O’Hehir, D. C. Wraith, W. R. Thomas, J. R. Lamb. 1993. Inhibition of T cell and antibody responses to house dust mite allergen by inhalation of the dominant T cell epitope in naive and sensitized mice. J. Exp. Med. 178:1783.[Abstract/Free Full Text]
  29. Xiao, B. G., H. Link. 1997. Mucosal tolerance: a two-edged sword to prevent and treat autoimmune diseases. Clin. Immunol. Immunopathol. 85:119.[Medline]
  30. Porgador, A., H. F. Staats, B. Faiola, E. Gilboa, T. J. Palker. 1997. Intranasal immunization with CTL epitope peptides from HIV-1 or ovalbumin and the mucosal adjuvant cholera toxin induces peptide-specific CTLs and protection against tumor development in vivo. J. Immunol. 158:834.[Abstract]
  31. Schuerer-Maly, C. C., L. Eckman, M. F. Kagnoff, M. T. Falco, F. E. Maly. 1994. Colonic epithelial cell lines as a source of interleukin-8: stimulation by inflammatory cytokines and bacterial lipopolysaccharide. Immunology 81:85.[Medline]
  32. McGee, D. W., K. W. Beagley, W. K. Aicher, J. R. McGhee. 1995. The regulation of IL-6 secretion from IEC-6 intestinal epithelial cells by cytokines and mucosally important antigens. Adv. Exp. Med. Biol. 371A:229.
  33. Panja, A., E. Siden, L. Mayer. 1995. Synthesis and regulation of accessory/proinflammatory cytokines by intestinal epithelial cells. Clin. Exp. Immunol. 100:298.[Medline]
  34. McGee, D. W., T. Bamberg, S. J. Vitkus, J. R. McGhee. 1995. A synergistic relationship between TNF-{alpha}, IL-1{beta}, and TGF-{beta}1 on IL-6 secretion by the IEC-6 intestinal epithelial cell line. Immunology 86:6.[Medline]
  35. Stadnyk, A. W., G. R. Sisson, C. C. Waterhouse. 1995. IL-1{alpha} is constitutively expressed in the rat intestinal epithelial cell line IEC-6. Exp. Cell Res. 220:298.[Medline]
  36. McGee, D. W., S. J. D. Vitkus, P. Lee. 1996. The effect of cytokine stimulation on IL-1 receptor mRNA expression by intestinal epithelial cells. Cell. Immunol. 168:276.[Medline]
  37. Panja, A., S. Goldberg, L. Eckmann, P. Krishen, L. Mayer. 1998. The regulation and functional consequence of proinflammatory cytokine binding on human intestinal epithelial cells. J. Immunol. 161:3675.[Abstract/Free Full Text]
  38. Belyakov, I. M., J. D. Ahlers, J. D. Clements, W. Strober, J. A. Berzofsky. 2000. Interplay of cytokines and adjuvants in the regulation of mucosal and systemic HIV-specific CTL. J. Immunol. 165:6454.[Abstract/Free Full Text]
  39. Jr Lillard, J. W., P. N. Boyaka, J. A. Hedrick, A. Zlotnik, J. R. McGhee. 1999. Lymphotactin acts as an innate mucosal adjuvant. J. Immunol. 162:1959.[Abstract/Free Full Text]
  40. Marinaro, M., P. N. Boyaka, R. J. Jackson, F. D. Finkelman, H. Kiyono, E. Jirillo, J. R. McGhee. 1999. Use of intranasal IL-12 to target predominantly Th1 responses to nasal and Th2 responses to oral vaccines given with cholera toxin. J. Immunol. 162:114.[Abstract/Free Full Text]
  41. Boyaka, P. N., M. Marinaro, R. J. Jackson, S. Menon, H. Kiyono, E. Jirillo, J. R. McGhee. 1999. IL-12 is an effective adjuvant for induction of mucosal immunity. J. Immunol. 162:122.[Abstract/Free Full Text]
  42. Christ, A. D., R. S. Blumberg. 1997. The intestinal epithelial cell: immunological aspects. Springer Semin. Immunopathol. 18:449.[Medline]
  43. Stern, A. S., U. Gubler, D. H. Presky, J. Magram. 1997. Structural and functional aspects of the IL-12 receptor complex. Chem. Immunol. 68:23.[Medline]
  44. Ahlers, J. D., N. Dunlop, D. W. Alling, P. L. Nara, J. A. Berzofsky. 1997. Cytokine-in-adjuvant steering of the immune response phenotype to HIV-1 vaccine constructs: granulocyte-macrophage colony-stimulating factor and TNF-{alpha} synergize with IL-12 to enhance induction of cytotoxic T lymphocytes. J. Immunol. 158:3947.[Abstract]
  45. Yamamoto, M., H. Kiyono, S. Yamamoto, E. Batanero, M. N. Kweon, S. Otake, M. Azuma, Y. Takeda, J. R. McGhee. 1999. Direct effects on antigen-presenting cells and T lymphocytes explain the adjuvanticity of a nontoxic cholera toxin mutant. J. Immunol. 162:7015.[Abstract/Free Full Text]
  46. Gajewski, T. F.. 1996. B7-1 but not B7-2 efficiently costimulates CD8+ T lymphocytes in the P815 tumor system in vitro. J. Immunol. 156:465.[Abstract]
  47. Matulonis, U., C. Dosiou, G. Freeman, C. Lamont, P. Mauch, L. M. Nadler, J. D. Griffin. 1996. B7-1 is superior to B7-2 costimulation in the induction and maintenance of T cell-mediated antileukemia immunity: further evidence that B7-1 and B7-2 are functionally distinct. J. Immunol. 156:1126.[Abstract]
  48. Fields, P. E., R. J. Finch, G. S. Gray, R. Zollner, J. L. Thomas, K. Sturmhoefel, K. Lee, S. Wolf, T. F. Gajewski, F. W. Fitch. 1998. B7.1 is a quantitatively stronger costimulus than B7.2 in the activation of naive CD8+ TCR-transgenic T cells. J. Immunol. 161:5268.[Abstract/Free Full Text]
  49. Staats, H. F., N. Sparks, L. Casey, G. Nabors, and R. S. Donder. 1999. IL-1{beta} is an effective adjuvant for nasal vaccines. In Seventh Annual Conference of the International Cytokine Society, December 8. Hilton Head, SC.



This article has been cited by other articles:


Home page
J. Immunol.Home page
M. Elnekave, M. Bivas-Benita, G. O. Gillard, P. Sircar, and A.-H. Hovav
A Matter of Timing: Unsynchronized Antigen Expression and Antigen Presentation Diminish Secondary T Cell Responses
J. Immunol., July 15, 2009; 183(2): 1013 - 1021.
[Abstract] [Full Text] [PDF]


Home page
BloodHome page
I. A. Parish, S. Rao, G. K. Smyth, T. Juelich, G. S. Denyer, G. M. Davey, A. Strasser, and W. R. Heath
The molecular signature of CD8+ T cells undergoing deletional tolerance
Blood, May 7, 2009; 113(19): 4575 - 4585.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
K. Yang, B. J. Whalen, R. S. Tirabassi, L. K. Selin, T. S. Levchenko, V. P. Torchilin, E. H. Kislauskis, and D. L. Guberski
A DNA Vaccine Prime Followed by a Liposome-Encapsulated Protein Boost Confers Enhanced Mucosal Immune Responses and Protection
J. Immunol., May 1, 2008; 180(9): 6159 - 6167.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
A.-H. Hovav, M. W. Panas, C. E. Osuna, M. J. Cayabyab, P. Autissier, and N. L. Letvin
The Impact of a Boosting Immunogen on the Differentiation of Secondary Memory CD8+ T Cells
J. Virol., December 1, 2007; 81(23): 12793 - 12802.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
A.-H. Hovav, M. W. Panas, S. Rahman, P. Sircar, G. Gillard, M. J. Cayabyab, and N. L. Letvin
Duration of Antigen Expression In Vivo following DNA Immunization Modifies the Magnitude, Contraction, and Secondary Responses of CD8+ T Lymphocytes
J. Immunol., November 15, 2007; 179(10): 6725 - 6733.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
I. M. Belyakov, D. Isakov, Q. Zhu, A. Dzutsev, and J. A. Berzofsky
A Novel Functional CTL Avidity/Activity Compartmentalization to the Site of Mucosal Immunization Contributes to Protection of Macaques against Simian/Human Immunodeficiency Viral Depletion of Mucosal CD4+ T Cells
J. Immunol., June 1, 2007; 178(11): 7211 - 7221.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
A.-H. Hovav, M. J. Cayabyab, M. W. Panas, S. Santra, J. Greenland, R. Geiben, B. F. Haynes, W. R. Jacobs Jr., and N. L. Letvin
Rapid Memory CD8+ T-Lymphocyte Induction through Priming with Recombinant Mycobacterium smegmatis
J. Virol., January 1, 2007; 81(1): 74 - 83.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
M. J. Cayabyab, A.-H. Hovav, T. Hsu, G. R. Krivulka, M. A. Lifton, D. A. Gorgone, G. J. Fennelly, B. F. Haynes, W. R. Jacobs Jr., and N. L. Letvin
Generation of CD8+ T-Cell Responses by a Recombinant Nonpathogenic Mycobacterium smegmatis Vaccine Vector Expressing Human Immunodeficiency Virus Type 1 Env
J. Virol., February 15, 2006; 80(4): 1645 - 1652.
[Abstract] [Full Text] [PDF]


Home page
J. Gen. Virol.Home page
M. M. Gherardi and M. Esteban
Recombinant poxviruses as mucosal vaccine vectors
J. Gen. Virol., November 1, 2005; 86(11): 2925 - 2936.
[Abstract] [Full Text] [PDF]


Home page
J. Gen. Virol.Home page
J. Stasakova, B. Ferko, C. Kittel, S. Sereinig, J. Romanova, H. Katinger, and A. Egorov
Influenza A mutant viruses with altered NS1 protein function provoke caspase-1 activation in primary human macrophages, resulting in fast apoptosis and release of high levels of interleukins 1{beta} and 18
J. Gen. Virol., January 1, 2005; 86(1): 185 - 195.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
J. W. Peacock, S. K. Nordone, S. S. Jackson, H.-X. Liao, N. L. Letvin, A. G. Yafal, L. Gritz, G. P. Mazzara, B. F. Haynes, and H. F. Staats
Gender Differences in Human Immunodeficiency Virus Type 1-Specific CD8 Responses in the Reproductive Tract and Colon following Nasal Peptide Priming and Modified Vaccinia Virus Ankara Boosting
J. Virol., December 1, 2004; 78(23): 13163 - 13172.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
C. Devito, B. Zuber, U. Schroder, R. Benthin, K. Okuda, K. Broliden, B. Wahren, and J. Hinkula
Intranasal HIV-1-gp160-DNA/gp41 Peptide Prime-Boost Immunization Regimen in Mice Results in Long-Term HIV-1 Neutralizing Humoral Mucosal and Systemic Immunity
J. Immunol., December 1, 2004; 173(11): 7078 - 7089.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
M. M. Gherardi, E. Perez-Jimenez, J. L. Najera, and M. Esteban
Induction of HIV Immunity in the Genital Tract After Intranasal Delivery of a MVA Vector: Enhanced Immunogenicity After DNA Prime-Modified Vaccinia Virus Ankara Boost Immunization Schedule
J. Immunol., May 15, 2004; 172(10): 6209 - 6220.
[Abstract] [Full Text] [PDF]


Home page
Infect. Immun.Home page
I. Castagliuolo, M. Sardina, P. Brun, C. DeRos, C. Mastrotto, L. Lovato, and G. Palu
Clostridium difficile Toxin A Carboxyl-Terminus Peptide Lacking ADP-Ribosyltransferase Activity Acts as a Mucosal Adjuvant
Infect. Immun., May 1, 2004; 72(5): 2827 - 2836.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
K. Kataoka, J. R. McGhee, R. Kobayashi, K. Fujihashi, S. Shizukuishi, and K. Fujihashi
Nasal Flt3 Ligand cDNA Elicits CD11c+CD8+ Dendritic Cells for Enhanced Mucosal Immunity
J. Immunol., March 15, 2004; 172(6): 3612 - 3619.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
M. S. Seaman, F. W. Peyerl, S. S. Jackson, M. A. Lifton, D. A. Gorgone, J. E. Schmitz, and N. L. Letvin
Subsets of Memory Cytotoxic T Lymphocytes Elicited by Vaccination Influence the Efficiency of Secondary Expansion In Vivo
J. Virol., January 1, 2004; 78(1): 206 - 215.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
C. P. Bradney, G. D. Sempowski, H.-X. Liao, B. F. Haynes, and H. F. Staats
Cytokines as Adjuvants for the Induction of Anti-Human Immunodeficiency Virus Peptide Immunoglobulin G (IgG) and IgA Antibodies in Serum and Mucosal Secretions after Nasal Immunization
J. Virol., January 15, 2002; 76(2): 517 - 524.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow Request Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Staats, H. F.
Right arrow Articles by Haynes, B. F.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Staats, H. F.
Right arrow Articles by Haynes, B. F.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS