|
|
||||||||
,
,
,¶
,¶
,¶
,¶
Departments of
*
Medicine,
Immunology, and
Pathology,
Human Vaccine Institute, and
¶ Center For AIDS Research, Duke University Medical Center, Durham, NC 27710; and
||
Harvard Medical School, and Division of Viral Pathogenesis, Department of Medicine, Beth Israel Deaconess Medical Center, Boston, MA 02215
| Abstract |
|---|
|
|
|---|
plus IL-18,
IL-1
plus IL-12, and IL-1
plus IL-12 plus GM-CSF each induced
optimal splenocyte anti-HIV CTL responses in immunized mice (range
6071% peptide-specific 51Cr release). Peak
H-2Dd-peptide tetramer-binding T cell responses induced by
cytokine combinations were up to 5.5% of CD8+ PBMC. Nasal
immunization with HIV immunogen and IL-1
, IL-12, and GM-CSF also
induced Ag-specific IFN-
-secreting cells in the draining cervical
lymph node and the lung. The use of IL-1
, IL-12, and GM-CSF as nasal
adjuvants was associated with an increased expression of MHC class II
and B7.1 on nonlymphocytes within the nasal-associated lymphoid
tissue/nasal mucosa. Thus, IL-1
, IL-12, IL-18, and GM-CSF are
critical cytokines for the induction of systemic and mucosal CTL after
nasal immunization. Moreover, these cytokines may serve as effective
adjuvants for nasal vaccine delivery. | Introduction |
|---|
|
|
|---|
Ags delivered via a nasal route first make contact with epithelial
cells. IL-1, IL-12, IL-18, GM-CSF, and IFN-
have all been implicated
in a cytokine pathway involved with the induction of MHC class
I-restricted CTL via production of IL-1
by the mucosal epithelium
(1) and APCs (6), followed by release of
IL-18 (7). Both IL-1 and IL-18 are produced by mucosal
epithelial cells (1, 8, 9, 10). IL-1 induces the production
of IL-12 and GM-CSF by resident macrophages and IFN-
by local NK and
T cells (11). IL-18 and IL-12 synergistically induce the
production of IFN-
by local NK cells (7). IFN-
enhances presentation of MHC class I-restricted Ags (12, 13). T cells responding to specific Ag produce GM-CSF that
activates macrophages and dendritic cells to enhance APC activity
(14, 15).
We recently reported that IL-1
and IL-1
exhibit mucosal adjuvant
activity for the induction of serum IgG and mucosal IgA Ab responses
when nasally administered with soluble protein Ags (16).
Although IL-1
and IL-1
could support the induction of humoral
immunity after nasal immunization with soluble protein Ags, the
induction of CTL after nasal immunization was not studied. Because CT
is not approved for use in humans, it would be advantageous to replace
CT as an adjuvant and to develop an adjuvant combination of cytokines
that maximally activated host immunity via nasal immunization.
Moreover, in doing so, we would define the cytokine requirements for
CTL induction via the nasal route. Therefore, we have evaluated
proinflammatory and immunoregulatory cytokines for their ability to
induce Ag-specific CTL after nasal immunization with a model soluble
protein HIV immunogen.
| Materials and Methods |
|---|
|
|
|---|
Female BALB/c mice, 1618 g, were purchased from Frederick Cancer Research and Developmental Center, National Cancer Institute (Frederick, MD). Animals were housed in filter top cages and provided food and water ad libitum. Procedures for use and care of mice were approved by Duke Universitys Institutional Animal Care and Use Committee.
Immunization
Mice were intranasally (i.n.) immunized, as previously described (16, 17, 18). Briefly, mice (three to five mice per group) were immunized i.n. with the indicated amount of HIV immunogen and the indicated adjuvant in a total volume of 15 µl sterile distilled water (7.5 µl/nostril), while mice were under isoflurane anesthesia (IsoFlo, USP; SOLVAY Animal Health, Mendota Heights, MN). The mucosal adjuvant CT was obtained from List Biological Laboratories (Campbell, CA). Recombinant murine cytokines were purchased from PeproTech (Rocky Hill, NJ), BioSource International (Camarillo, CA), or Chemicon (Temecula, CA).
HIV synthetic peptides
Synthetic HIV peptides C4-V3IIIB and
C4-V3MN were used as HIV immunogens (17, 19, 20, 21). The amino acid sequence for
C4-V3IIIB is
KQIINMWQEVGKAMYATRPNNNTRKSIRIQRGPGRAFVTI. The amino acid sequence
for C4-V3MN is
KQIINMWQEVGKAMYATRPNYNKRKRIHIGPGRAFYTTK. Smaller synthetic peptides
from the gp120 V3 loop of HIV-1IIIB (RGPGRAFVTI)
and HIV-1MN (RIHIGPGRAFYTTKN) containing the
H-2Dd-restricted CTL epitopes were used for in
vitro restimulation of CTL effector cells, labeling of CTL target
cells, and antigenic stimulation of splenocytes in the IFN-
ELISPOT
assay. Peptides used for immunization of mice were purchased from
SynPep (Dublin, CA) and purified to a single species by HPLC and
verified by mass spectroscopy. Peptides used for in vitro assays were
purchased from SYNPEP as HPLC-purified peptides with >80% purity.
Peptide mass was verified by mass spectroscopy.
CTL assay
Restimulation of effector cells. BALB/c splenocytes were removed, purified by lymphocyte separation medium (ICN Biomedicals, Aurora, OH), and used as effector cells to monitor HIV-specific CTL responses. Splenocytes were resuspended in CTL media (RPMI 1640, 10% FBS, HEPES, penicillin/streptomycin, nonessential amino acids, essential amino acids, 2-ME, 2 ml 2 N NaOH, sodium pyruvate) at a cell density of 1 x 107 cells/ml. Effector cells were added to wells in a 24-well plate (750 µl/well), followed by the addition of 1 ml CTL media containing the appropriate CTL epitope peptide at 1.75 µg/ml to each well to give a final peptide concentration of 1 µg/ml. Splenocytes from naive mice were also restimulated to determine whether in vitro restimulation induced peptide-specific CTL. Cells were incubated in 10% CO2, at 37°C. On day 2 or 3, 500 µl CTL media containing murine rIL-2 (at 45 U/ml) were added to each well of CTL effector cells to give a final concentration of 10 U/ml murine rIL-2. Effector cells were tested in a chromium release assay after restimulation for 7 days.
Chromium release assay. A standard chromium release assay was used to monitor CTL activity. Briefly, target cells were pulsed with 100 µCi/ml 51Cr ± 40 µg/ml CTL epitope peptide for 34 h before use in the 4-h chromium release assay. Percent specific lysis was calculated as follows: ((experimental cpm - spontaneous cpm)/(maximum cpm - spontaneous cpm)) x 100. Results are presented as peptide-specific lysis, calculated by subtracting the percent specific lysis of control target cells from the percent specific lysis of the peptide-pulsed target cells at the same E:T ratio.
IFN-
ELISPOT
Millipore MAHA S45 96-well multiscreen plates were coated with
50 µl/well anti-mouse IFN-
capture Ab (catalog 18180D; BD
PharMingen, San Diego, CA) diluted to 5 µg/ml in sterile PBS. Plates
were incubated overnight at 4°C or 3 h at 37°C. After
incubation, plates were washed three times with sterile PBS, 100
µl/well, and then blocked with CTL media, 100 µl/well for at least
30 min. Blocking media were removed, and 100 µl cells ± Ag (CTL
epitope peptide at 1 µg/ml final concentration) were added to
appropriate wells. Cells were added at concentrations to give 5 x
105, 2.5 x 105, and
1.25 x 105 cells/well. Plates were
incubated at 37°C, 10% CO2 in air, humidified
atmosphere for 3648 h. After incubation, plates were washed three
times with 100 µl PBS, followed by three times with 100 µl
PBS-Tween. Anti-IFN-
detection Ab (BD PharMingen; 18112D) was
diluted to 5 µg/ml in PBS-10% FBS, and 50 µl well was added to
each well and incubated at room temperature for 3 h. After
incubation, plates were washed six times with PBS-Tween, and
streptavidin-HRP (BD PharMingen; 3047E) diluted 1/500 in PBS-10% FBS
was added to each well (50 µl/well) and incubated at room temperature
for 1 h. After incubation, plates were washed six times with
PBS-Tween and developed with 100 µl/well
3-amino-9-ethylcarbazole substrate (according to manufacturers
instructions; Pierce Chemical, Rockford, IL) at room temperature for up
to 1 h. The reaction was stopped by rinsing plate in tap water.
The plastic support from back of 96-well filter plates was removed and
plates were air dried overnight before spots were counted with a Leica
(Deerfield, IL) StereoZoom 5 microscope with fiber optic ring lamp. The
frequency of peptide-specific IFN-
producing cells per
106 cells was calculated by subtracting the number of
IFN-
spot-forming cells (SFC)/106 detected in the
absence of CTL peptide stimulation from the number of IFN-
SFC/106 detected in the presence of CTL peptide
stimulation.
MHC class I-peptide tetramer-binding assay; tetrameric H-2Dd/p18 complex formation
A pET-3d vector containing DNA coding for the soluble
domain of H-2Dd with a 3' BirA substrate peptide,
generated as described by Altman et al. (22) and Kuroda et
al. (23), was kindly provided by C. Bergmann (University
of Southern California, Los Angeles, CA) for tetramer
production. Inclusion bodies containing H-2Dd
chains were prepared from
isopropyl-1-thio-
-D-galactopyranoside-stimulated
cultures of the BL21(DE3)pLysS strain of Escherichia coli
(Stratagene, La Jolla, CA) by repeated sonication in 40 mM Tris (pH 8),
10 mM EDTA, 0.2 M NaCl, 0.1 mM PMSF, 10 mM DTT, and 0.5% Triton X-100.
Human
2-microglobulin
(
2m) was similarly expressed in cultures of
XA90 E. coli. The inclusion body preparations were dissolved
in 6 M guanidine-HCl, 20 mM HEPES, 10 mM EDTA, and 10 mM DTT.
The H-2Dd-restricted p18 peptide, a 10-aa
fragment of HIV-1 IIIB Env (aa 318327), was used to induce folding of
the H-2Dd MHC class I molecule and
2m. Folding was initiated by diluting the
subunits to 45 µM
2m and 12 µM
Dd in a buffer containing 20 µM p18 and
comprised of 400 mM L-arginine-HCl, 100 mM Tris (pH 8.3), 2
mM EDTA, 0.5 mM oxidized glutathione, 5 mM reduced glutathione, and 0.2
mM PMSF. After incubation for 2 days at 4°C, the folded
H-2Dd/p18 monomers were purified on a MonoQ
column (Pharmacia, Piscataway, NJ) in 20 mM Tris (pH 8) with a gradient
of NaCl from 0 to 0.5 M. Purified H-2Dd monomers
were biotinylated with BirA enzyme (Avidity, Denver, CO), following the
manufacturers instructions (efficiency of biotinylation, 8095%).
Free biotin was removed from the monomers via a Superdex 200 HR 10/30
gel filtration column (Pharmacia). Monomers were stored in PBS (pH 8)
containing 15 µg/ml benzamidine HCl, 10 µg/ml phenanthroline, 10
µg/ml aprotinin, 10 µg/ml leupeptin, 10 µg/ml pepstatin A, 1 mM
PMSF, and 0.01% NaN3. Tetramers were generated
by mixing PE-labeled streptavidin (Prozyme, San Leandro, CA) at a 4:1
molar ratio and stored with protease inhibitors, as above.
Staining and phenotypic analysis of p18-specific CD8+ T cells
A total of 0.10.2 µg PE-labeled tetrameric complex was used
in conjunction with anti-CD8
(clone 53-6.7; BD PharMingen)
conjugated to PerCP to stain 100 µl blood processed, as indicated
below. Peripheral blood samples were diluted in RPMI (40 U/ml sodium
heparin). Samples were washed with RPMI and lysed in 144 mM
NH4Cl, 17 mM Tris buffer (pH 7.2). The samples
were resuspended (to 100 µl/sample) for staining in PBS/2% FCS.
Samples were incubated with the tetrameric complexes, followed by
incubation with anti-CD8
(15 min at room temperature). Cells
were washed with PBS/2% FCS, resuspended in 0.5 ml PBS containing
1.5% paraformaldehyde, and analyzed on a BD Biosciences (Mountain
View, CA) FACSCalibur.
Isolation of lung cells
Cells within the circulatory system of the lung were removed by
injecting digestion media (RPMI 1640, 5% FBS, HEPES,
penicillin/streptomycin, 2.5 mg/ml collagenase A; Roche
Molecular Biochemical 1088 785, Indianapolis, IN) and 34 U/ml DNase I,
grade II (Roche Molecular Biochemical 104 159) into the right ventricle
of the heart until the lung became white. The lung was then removed and
placed in digestion media and minced into small pieces (<2
mm2) using scissors. Lung tissue was then placed
in a 50-ml Erlenmeyer flask with 25 ml digestion media and a stir bar
and placed on a magnetic stirrer housed in an incubator at 37°C and
5% CO2. The lung tissue was digested for up to
2 h and then filtered through a 40-µm cell strainer (catalog
35-2340; Falcon, Franklin Lakes, NJ). Isolated lung cells were
pelleted, resuspended in 10 ml room temperature 44% Percoll (Amersham
Pharmacia Biotech, Piscataway, NJ), and then layered over 10 ml
lymphocyte separation media (ICN Biomedicals) in a 50-ml centrifuge
tube and centrifuged for 20 min at 1800 rpm. Cells at the
Percoll-lymphocyte separation media interface were collected, washed,
and used in the IFN-
ELISPOT assay.
Phenotypic characterization of nasal-associated lymphoid tissue (NALT) and nasal mucosa cells using flow cytometry
Cells were harvested from the NALT and nasal mucosa as follows.
The skin was removed from the head, and the lower jaw was removed.
Scissors were used to cut the skull behind the eyes, removing the
posterior portion of the snout from the rest of the skull. The bony
skull was then cut from the opening of each nostril to the eye socket
on each side of the skull. The nasal septum was cut, and the top
portion of the skull was removed, leaving the palate and associated
nasal tissues. Scissors were used to make a cross section cut to remove
the upper incisors. Cells in the NALT and nasal mucosa area were
removed by mechanically scraping the area immediately above the soft
palate that contains the NALT structures (24). Cells from
five mice per group were pooled in media (RPMI 1640, 5% FBS). Cells
were filtered using a 40-µm cell strainer (Falcon; catalog 35-2340).
RBC were removed using ammonium chloride lysis buffer. NALT/nasal
mucosa cells were then washed, incubated on ice with unlabeled mouse
IgG2a (10 µg/106; Southern Biotechnology
Associates, Birmingham, AL) cells to block Fc
receptors, washed, and
then resuspended to 3 x 106 cells/ml.
Fluorescently labeled and biotinylated mAbs (BD PharMingen) were
diluted in wash buffer (PBS, 1% FBS, 0.1% Kathon), and a total volume
of 50 µl containing 0.25 µg of each appropriate Ab was added per
well of a 96-well round-bottom plate. A total of 150,000 cells in 50
µl media was added per well (to give a 100 µl final volume), gently
mixed, and stained for 30 min at 4°C in the dark. Cells were stained
with FITC anti-CD3, PE anti-pan NK, CyChrome anti-CD8, FITC
anti-B220, FITC anti-CD11c, or APC anti-Gr-1. Appropriate
negative (isotype) and positive controls for each fluorescent label
were also included. For analysis of MHC class II, B7.1, and B7.2, cells
were triple stained with FITC anti-CD3; PE anti-CD19; and
either biotinylated anti-MHC class II, anti-B7.1, or
anti-B7.2 for 30 min in the dark at 4°C. After washing, secondary
labeling with streptavidin-APC was performed for 20 min in the dark at
4°C. Cells were washed after staining with wash buffer and
resuspended in 200 µl/well fluorescent fixative (PBS, 1%
formaldehyde, 0.1% Kathon). Cells were transferred to polystyrene
tubes containing an additional 300 µl fluorescent fixative (0.5 ml
final volume), gently mixed, and analyzed with a FACSVantage SE from BD
Biosciences using CellQuest software. To distinguish between
lymphocytes and nonlymphocytes, analysis of MHC class II, B7.1, and
B7.2 was performed using CD3+ or
CD19+ or CD3- and
CD19- gated cells. All viable cells, based on
forward and side scatter, were gated to include all cell populations
present in the NALT/nasal mucosa.
Statistical analysis
Statistical analysis was determined using t test analysis. Because the comparison of activity between control groups (nasal immunization with peptide without adjuvant to nasal immunization with peptide plus adjuvant) was planned a priori, t tests were performed to compare each experimental group with the control group (25, 26) The level of significance used was 0.05. Error bars represent SD.
| Results |
|---|
|
|
|---|
secretion after nasal administration
with an HIV immunogen
BALB/c mice were nasally immunized with the
C4-V3IIIB HIV-1 immunogen at 1, 10, or 100
µg ± cytokines on days 0, 7, 14, and 28 to identify cytokines
involved with the induction of HIV-1-specific CTL. Cytokines tested
included IL-1
, IL-12, IL-18, IL-12 and IL-18, and GM-CSF (Table I
). Nasal administration of adjuvants
alone or C4-V3IIIB alone induced only background
levels of 51Cr release (Fig. 1
). When 10 µg
C4-V3IIIB was used as the nasal immunogen, CT was
able to induce HIV-specific cell lysis that was significantly elevated
compared with mice nasally immunized with 10 µg
C4-V3IIIB alone (61.4 ± 2.66% vs
19.41 ± 6.95% HIV peptide-specific lysis, respectively,
p = 0.0003) (Fig. 1
). Nasal immunization with 10 µg
C4-V3IIIB and CT was also the group with the
absolute highest level of HIV-specific cell lysis (Fig. 1
). Cytokines
that were able to induce significant CTLresponses
(p < 0.02) include IL-1
, IL-18, and IL-12
and IL-18 when nasally administered with 100 µg HIV immunogen. Nasal
immunization with 100 µg C4-V3IIIB alone
induced 13.67 ± 1.7% peptide-specific lysis, while that addition
of IL-1
, IL-18, or IL-12 and IL-18 increased peptide-specific lysis
to 42.44 ± 14.2, 23.96 ± 5.5, and 46.29 ± 6.6%
peptide-specific lysis, respectively. GM-CSF nor IL-12 alone induced
significant increases in CTL lytic activity. Therefore, IL-1
, IL-18,
and the combination of IL-12 and IL-18 were important for the induction
of peptide-specific CTL after nasal immunization.
|
|
secretion using the ELISPOT assay (Fig. 2
-secreting cells
was immunized i.n. with 10 µg C4-V3IIIB and CT
(Fig. 2
, IL-18, IL-12 and IL-18, and GM-CSF induced
IFN-
-secreting cell frequencies (199.7 ± 70.2, 150.5 ±
89.5, 49.5 ± 23.4, 89 ± 51.2, and 137.7 ± 73.1
IFN-
SFC/106 splenocytes, respectively)
significantly (p < 0.03) above those detected
in mice immunized with 100 µg C4-V3IIIB only
(13.67 ± 4.5 IFN-
SFC/106 splenocytes).
Thus, IL-1
alone, IL-18 alone, IL-12 and IL-18 in combination, and
GM-CSF alone were important for nasal induction of Ag-specific
IFN-
-secreting cells.
|
-producing T cells, and
H-2Dd-peptide tetramer-positive CD8+ T cells
comparable with CT
Next, more complex combinations of cytokines were tested for their
ability to induce HIV-specific CTL, IFN-
secretion, and tetramer
binding comparable with those induced with the use of CT. Because the
highest level of Ag-specific CTL activity and IFN-
secretion was
detected after i.n. immunization with 10 µg
C4-V3IIIB and CT (Figs. 1
and 2
), the 10 µg
dose of C4-V3IIIB was used for the remaining
studies. Mice were immunized nasally with 10 µg
C4-V3IIIB alone or in the presence of CT or
cytokine combinations. As previously observed, nasal immunization with
10 µg C4-V3IIIB and CT induced CTL lytic
activity (40.96 ± 0.48% peptide-specific lysis) that was
significantly increased compared with the CTL activity detected in
naive animals or animals immunized with C4-V3IIIB
alone (14.62 ± 2.72% and 15.18 ± 0.37% peptide-specific
lysis, respectively, p < 0.00001) (Fig. 3
). Cytokine combinations that induced
CTL lytic activities that were significantly increased compared with
immunization with C4-V3IIIB alone included
IL-1
plus IL-18 (p < 0.00001), GM-CSF plus
IL-12 plus IL-18 (p < 0.05),
IL-1
plus GM-CSF (p < 0.001), IL-1
plus IL-12 (p < 0.00001), IL-1
plus IL-18
(p < 0.00001), IL-1
plus IL-12 plus IL-18
plus GM-CSF (p < 0.0002), and IL-1
plus
IL-12 plus GM-CSF (p < 0.0006) (Fig. 3
).
Importantly, the combinations of IL-1
plus GM-CSF, IL-1
plus
IL-12, IL-1
plus IL-18, IL-1
plus IL-12 plus GM-CSF, and IL-1
plus IL-12 plus IL-18 plus GM-CSF induced the highest CTL lytic
activities (59.55 ± 10.5, 59.6 ± 3.7, 64.33 ± 5.2,
71.66 ± 11.7, 67.01 ± 7.1% peptide-specific lysis,
respectively) that were all significantly increased compared with that
induced by nasal immunization with C4-V3IIIB and
CT (p < 0.02) (Fig. 3
).
|
-secreting cells in splenocytes
after nasal immunization with immunogen and complex cytokine
combinations was next determined using the ELISPOT technique. Nasal
immunization with C4-V3IIIB and CT induced
152.6 ± 20.9 IFN-
-secreting cells/106
splenocytes, while nasal immunization with
C4-V3IIIB only induced 3.66 ± 6.35
IFN-
-secreting cells/106 splenocytes.
Significant increases in peptide-specific IFN-
secretion were
observed in all groups, except GM-CSF and IL-12 used alone
(p < 0.05) (Fig. 4
-secreting splenocytes was greater than
200/106 splenocytes when IL-1
plus IL-18,
IL-1
plus IL-12 plus GM-CSF, IL-1
plus IL-18 plus GM-CSF, and
IL-1
plus IL-12 plus IL-18 plus GM-CSF were used as adjuvants
(236 ± 117, 209 ± 46, 227 ± 107, and 231 ± 68
IFN-
SFC/106 splenocytes, respectively)
(Fig. 4
|
(p < 0.0004), GM-CSF
(p < 0.02), IL-12 plus IL-18
(p < 0.02), GM-CSF plus IL-12 plus IL-18
(p < 0.004), IL-1
plus GM-CSF
(p < 0.004), IL-1
plus IL-12
(p < 0.02), IL-1
plus IL-18
(p < 0.0002), IL-1
plus IL-12 plus GM-CSF
(p < 0.02), IL-1
plus IL-18 plus GM-CSF
(p < 0.0006), and IL-1
plus IL-12 plus
IL-18 plus GM-CSF (p < 0.0004) (Fig. 5
plus IL-18 induced the absolute highest
percentage of tetramer+ cells in the
CD8+ PBMC pool with 5.52 ± 0.71%. The
percentage of tetramer+ cells induced by IL-1
plus IL-18 was significantly increased compared with the percentage of
tetramer+ cells induced by CT
(p < 0.006).
|
plus IL-12 plus IL-18 plus GM-CSF with 41.47 ± 9.53%
Ag-specific lysis when tested at a 20:1 E:T ratio (Fig. 6
plus IL-12 plus GM-CSF and CT induced 35.12 ± 7.9% and
32.07 ± 3.44% specific release, respectively, at 20:1 E:T
ratio.
|
-secreting cells in systemic and mucosal
tissues
The induction of HIV-specific cell-mediated immunity at mucosal
surfaces may be important for vaccine-induced protection against
mucosal transmission of HIV. We therefore determined whether nasal
immunization with HIV immunogen and the cytokine adjuvant combination
of IL-1
, IL-12, and GM-CSF induced HIV-specific IFN-
-secreting
cells in the draining cervical lymph node (the lymph node that drains
the NALT), spleen, and lung (as a representative mucosal tissue). Nasal
immunization with 10 µg C4-V3IIB and IL-1
,
IL-12, and GM-CSF induced 311 ± 56.7, 356 ± 50.9, and
318 ± 145.2 HIV-specific IFN-
SFC/106
cells in the cervical lymph node, spleen, and lung, respectively
(p
0.01 vs peptide only; Fig. 7
). Nasal immunization with peptide alone
induced IFN-
SFC responses less than three IFN-
SFC/106 cells, while naive mice had no detectable
HIV-specific IFN-
SFC responses in any tissue (Fig. 7
).
|
To determine whether there was an association between 1) the use
of cytokines as mucosal adjuvants, 2) the induction of HIV-specific
IFN-
SFC responses, and 3) changes in the cellular populations
within the NALT/nasal mucosal, cells were isolated from the NALT/nasal
mucosa of mice used in the experiment for Fig. 7
and analyzed via flow
cytometry for the expression of CD3, B220, DX5 (pan-NK), CD11c, Gr-1,
MHC class II, B7.1, and B7.2 (Table II
).
Mice immunized with HIV immunogen plus IL-1
, IL-12, and GM-CSF had
34.25 ± 2.77% CD3+ cells in the NALT/nasal
mucosal, while mice immunized with HIV immunogen had 21.4 ±
3.62% CD3+ cells (p
0.05). The use of IL-1
, IL-12, and GM-CSF was also associated with a
significant decrease in B220+ cells since mice
immunized with immunogen only had 29.5 ± 2.79%
B220+ cells, while mice immunized with immunogen
and IL-1
, IL-12, and GM-CSF had 20.38 ± 1.88%
B220+ cells (p
0.05).
|
, IL-12, and GM-CSF as mucosal adjuvants. The use of
IL-1
, IL-12, and GM-CSF was associated with an increase in both the
percentage of positive cells and the mean fluorescence intensity (MFI)
of cells in the nonlymphocyte gate when assayed for reactivity with Abs
to MHC class II, B7.1, and B7.2, although only the changes in MHC class
II and B7.1 were statistically significant (Table II
, IL-12, and GM-CSF were used as a
mucosal adjuvant (p
0.05). The MFI for MHC
class II staining on nonlymphocytes increased from 74.02 ± 30.97
to 205.36 ± 39.85 with the use of IL-1
, IL-12, and GM-CSF
(p
0.05). The number of nonlymphocytes
expressing B7.1+ also increased from 7.89 ±
3.90% to 13.22 ± 1.87% with the use of IL-1
, IL-12, and
GM-CSF (p = 0.05). The MFI for B7.1 expression
on nonlymphocytes increased from 6.17 ± 5.30 to 13.6 ± 2.93
when IL-1
, IL-12, and GM-CSF were used as a mucosal adjuvant
(p = 0.05). | Discussion |
|---|
|
|
|---|
plus IL-12 plus GM-CSF and IL-1
plus IL-18 were able to
substitute for CT as a nasal adjuvant when administered with a model
HIV immunogen and support the induction of Ag-specific CTL,
IFN-
-producing cells, and
H-2Dd-tetramer-binding,
CD8+ peripheral blood T cells. Importantly, nasal
immunization with immunogen and combinations of IL-1
plus GM-CSF,
IL-1
plus IL-12, IL-1
plus IL-18, IL-1
plus IL-12 plus GM-CSF,
or IL-1
plus IL-12 plus IL-18 plus GM-CSF induced CTL responses that
were significantly greater than those induced by nasal immunization
with peptide and CT. Nasal immunization with Ag alone may induce Ag-specific mucosal tolerance (27, 28, 29), while nasal immunization with Ag and adjuvant has the potential to induce Ag-specific responses, including systemic and mucosal IgG and IgA and systemic CTL (16, 17, 30). Adjuvants induce cytokine production and release at the site of immunization that play a crucial role in the induction of Ag-specific immune responses. Mucosal epithelial cells are able to produce numerous cytokines that may be involved with the induction and regulation of immunity, including IL-1, IL-6, IL-18, and IL-8 (31, 32, 33, 34, 35). Mucosal epithelial cells are also responsive to local cytokine expression since they express receptors IL-1, IL-6, and GM-CSF (36, 37).
To our knowledge, this is the first report of the ability of cytokines
alone to induce CTL after mucosal immunization with Ag. The cytokines
GM-CSF and IL-12 have been reported to augment CTL induction after
intrarectal immunization of mice with an HIV peptide immunogen when CT
was used as an adjuvant (38). We previously determined
that IL-1
and IL-1
were able to support the induction of
Ag-specific serum IgG and mucosal IgA as well as CT after nasal
immunization of mice (16). Others have reported that
lymphotactin was able to support the induction of Ag-specific humoral
and Th responses after nasal administration with the protein Ag OVA
(39). IL-12 has also been reported to have adjuvant
activity for the induction of humoral and Th responses when nasally
administered with Ag (40, 41). However, in these studies,
IL-12 was formulated with liposomes and administered on days 0, 3, 7,
10, 14, and 17, while Ag was administered on days 0, 7, and 14. In our
present study, cytokines were formulated with Ag in distilled water and
coadministered at the same time.
Some cytokines evaluated in our study were active when delivered i.n.,
while others were not. For example, IL-1, IL-18, and GM-CSF exhibit
activity for the induction of CTL when delivered i.n. with 100 µg
C4-V3IIIB HIV immunogen, while IL-12 was not.
This may be explained by the finding that mucosal epithelial cells
express receptors for IL-1 and GM-CSF (37, 42). Therefore,
IL-1 and GM-CSF are able to bind to their specific receptors on the
mucosal epithelial cells, exert their biological activity, and support
the induction of CTL. A possible explanation of the lack of adjuvant
activity observed with the use of IL-12 alone is that the mucosal
epithelial cells may not express receptors for IL-12 (43).
We found IL-12 enhanced the induction of CTL when administered with
IL-1
. One possible explanation to this latter observation is that
IL-1 increases the permeability of nasal mucosa and allows IL-12 to
cross the mucosal epithelium and exert its biological activity in the
NALT. Although others have reported that IL-12 exhibits mucosal
adjuvant activity after nasal administration (as mentioned previously)
(41), the use of liposomes in the IL-12 formulation along
with a higher dose of IL-12 (1 µg) and more frequent administration
may have permitted the IL-12 to be active when administered by the
nasal route.
Others have reported that cytokines were able to regulate the immune
responses induced when systemically administered with HIV immunogens
similar to the immunogens used in this study (44). In this
previously published study, cytokines were formulated with peptide in
incomplete Seppic adjuvant (mineral oil plus mannose manoleate) and
administered s.c. Subcutaneous administration of immunogen and
cytokines determined that GM-CSF was the most effective single cytokine
for enhancement of cellular and humoral immunity (44).
Interestingly, this study also observed that IL-1
significantly
suppressed the CTL response (44). The difference between
this published study and our current study is likely to be associated
with the formulation of the Ag-cytokine mixtures and the route of
immunization.
Nasal immunization with HIV immunogen and IL-1
, IL-12, and GM-CSF
was associated with increased expression of MHC class II and B7.1 and
B7.2 on nonlymphocytes within the NALT, although only the increase for
MHC class II and B7.1 expression was statistically significant. Others
have also reported that up-regulation of costimulatory molecules was
observed when CT or mutant CT was used as a mucosal adjuvant (3, 45). When used to stimulate C57BL/6 T-depleted Peyers patch
(PP) cells in vitro, mutant CT enhanced the expression of B7.2 and B7.1
on B220+ and Mac-1+ cells
(45). Stimulation of C57BL/6 M-CSF-generated or
GM-CSF-activated bone marrow macrophages with CT was associated with an
increased expression of B7.2, but not B7.1 (3). Gastric
inoculation of C57BL/6 mice with 10 µg CT was associated with
up-regulation of B7.2 expression on both Mac-1+
and CD11c+ cells isolated from the PP 24 h
after the single CT treatment; the increase was statistically
significant for the Mac-1+ cells only
(3). It is not obvious why we observed significant
up-regulation of B7.1 while others report a predominant up-regulation
of B7.2. A difference between our experiment and the previously
published work is that we used BALB/c mice, while the others used
C57BL/6 mice. We also isolated cells from the NALT/nasal mucosal after
nasal immunization, while the others utilized bone marrow macrophages
or PP cells and gastric inoculation for their studies. We analyzed
expression of costimulatory molecules with NALT/nasal mucosal cells
isolated after four nasal immunizations with HIV immunogen and cytokine
adjuvants, while others evaluated costimulatory molecule expression
24 h after intragastric inoculation or in vitro stimulation with
CT or mutant CT, respectively (3, 45). It has been
reported that B7.1 is more efficient than B7.2 for the induction of
CD8+ T cell-mediated immune responses
(46, 47, 48). Our vaccination regimen utilized an
immunogen-adjuvant formulation that induced MHC class I-restricted,
CD8+-mediated IFN-
production and CTL.
Therefore, it is possible that repeated immunization with the HIV
immunogen and adjuvant formulation preferentially up-regulated
expression of B7.1 for the induction of
CD8+-mediated immunity.
Thus, our study has demonstrated that cytokine combinations containing
IL-1
, IL-12, IL-18, and/or GM-CSF could substitute completely for CT
as a nasal adjuvant. It is important to note that up to 30 µg IL-1
administered i.n. to rabbits did not induce a febrile response
(49). Thus, combinations of these cytokines are prime
candidates for use as adjuvants with HIV and other vaccines.
| Acknowledgments |
|---|
| Footnotes |
|---|
2 Address correspondence and reprint requests to Dr. Herman F. Staats, Department of Medicine, Duke University Medical Center, Box 3307, Durham, NC 27710. E-mail address: hfs{at}acpub.duke.edu ![]()
3 Abbreviations used in this paper: CT, cholera toxin;
2m,
2-microglobulin; i.n., intranasal; MFI, mean fluorescence intensity; NALT, nasal-associated lymphoid tissue; PP, Peyers patch; SFC, spot-forming cell. ![]()
Received for publication November 30, 2000. Accepted for publication August 22, 2001.
| References |
|---|
|
|
|---|
, interleukin-1
and interferon-
-inducing factor on the production of interferon-
by natural killer. Eur. J. Immunol. 27:2787.[Medline]
-inducing factor ("interleukin-18") in mouse intestinal epithelial cells. Cell Tissue Res. 289:499.[Medline]
. Curr. Opin. Immunol. 11:76.[Medline]
-inducible proteasome activator PA28. Immunol. Rev. 163:161.[Medline]
, IL-1
, and TGF-
1 on IL-6 secretion by the IEC-6 intestinal epithelial cell line. Immunology 86:6.[Medline]
is constitutively expressed in the rat intestinal epithelial cell line IEC-6. Exp. Cell Res. 220:298.[Medline]
synergize with IL-12 to enhance induction of cytotoxic T lymphocytes. J. Immunol. 158:3947.[Abstract]
is
an effective adjuvant for nasal vaccines. In Seventh Annual
Conference of the International Cytokine Society, December 8.
Hilton Head, SC.This article has been cited by other articles:
![]() |
M. Elnekave, M. Bivas-Benita, G. O. Gillard, P. Sircar, and A.-H. Hovav A Matter of Timing: Unsynchronized Antigen Expression and Antigen Presentation Diminish Secondary T Cell Responses J. Immunol., July 15, 2009; 183(2): 1013 - 1021. [Abstract] [Full Text] [PDF] |
||||
![]() |
I. A. Parish, S. Rao, G. K. Smyth, T. Juelich, G. S. Denyer, G. M. Davey, A. Strasser, and W. R. Heath The molecular signature of CD8+ T cells undergoing deletional tolerance Blood, May 7, 2009; 113(19): 4575 - 4585. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. Yang, B. J. Whalen, R. S. Tirabassi, L. K. Selin, T. S. Levchenko, V. P. Torchilin, E. H. Kislauskis, and D. L. Guberski A DNA Vaccine Prime Followed by a Liposome-Encapsulated Protein Boost Confers Enhanced Mucosal Immune Responses and Protection J. Immunol., May 1, 2008; 180(9): 6159 - 6167. [Abstract] [Full Text] [PDF] |
||||
![]() |
A.-H. Hovav, M. W. Panas, C. E. Osuna, M. J. Cayabyab, P. Autissier, and N. L. Letvin The Impact of a Boosting Immunogen on the Differentiation of Secondary Memory CD8+ T Cells J. Virol., December 1, 2007; 81(23): 12793 - 12802. [Abstract] [Full Text] [PDF] |
||||
![]() |
A.-H. Hovav, M. W. Panas, S. Rahman, P. Sircar, G. Gillard, M. J. Cayabyab, and N. L. Letvin Duration of Antigen Expression In Vivo following DNA Immunization Modifies the Magnitude, Contraction, and Secondary Responses of CD8+ T Lymphocytes J. Immunol., November 15, 2007; 179(10): 6725 - 6733. [Abstract] [Full Text] [PDF] |
||||
![]() |
I. M. Belyakov, D. Isakov, Q. Zhu, A. Dzutsev, and J. A. Berzofsky A Novel Functional CTL Avidity/Activity Compartmentalization to the Site of Mucosal Immunization Contributes to Protection of Macaques against Simian/Human Immunodeficiency Viral Depletion of Mucosal CD4+ T Cells J. Immunol., June 1, 2007; 178(11): 7211 - 7221. [Abstract] [Full Text] [PDF] |
||||
![]() |
A.-H. Hovav, M. J. Cayabyab, M. W. Panas, S. Santra, J. Greenland, R. Geiben, B. F. Haynes, W. R. Jacobs Jr., and N. L. Letvin Rapid Memory CD8+ T-Lymphocyte Induction through Priming with Recombinant Mycobacterium smegmatis J. Virol., January 1, 2007; 81(1): 74 - 83. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. J. Cayabyab, A.-H. Hovav, T. Hsu, G. R. Krivulka, M. A. Lifton, D. A. Gorgone, G. J. Fennelly, B. F. Haynes, W. R. Jacobs Jr., and N. L. Letvin Generation of CD8+ T-Cell Responses by a Recombinant Nonpathogenic Mycobacterium smegmatis Vaccine Vector Expressing Human Immunodeficiency Virus Type 1 Env J. Virol., February 15, 2006; 80(4): 1645 - 1652. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. M. Gherardi and M. Esteban Recombinant poxviruses as mucosal vaccine vectors J. Gen. Virol., November 1, 2005; 86(11): 2925 - 2936. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. Stasakova, B. Ferko, C. Kittel, S. Sereinig, J. Romanova, H. Katinger, and A. Egorov Influenza A mutant viruses with altered NS1 protein function provoke caspase-1 activation in primary human macrophages, resulting in fast apoptosis and release of high levels of interleukins 1{beta} and 18 J. Gen. Virol., January 1, 2005; 86(1): 185 - 195. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. W. Peacock, S. K. Nordone, S. S. Jackson, H.-X. Liao, N. L. Letvin, A. G. Yafal, L. Gritz, G. P. Mazzara, B. F. Haynes, and H. F. Staats Gender Differences in Human Immunodeficiency Virus Type 1-Specific CD8 Responses in the Reproductive Tract and Colon following Nasal Peptide Priming and Modified Vaccinia Virus Ankara Boosting J. Virol., December 1, 2004; 78(23): 13163 - 13172. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. Devito, B. Zuber, U. Schroder, R. Benthin, K. Okuda, K. Broliden, B. Wahren, and J. Hinkula Intranasal HIV-1-gp160-DNA/gp41 Peptide Prime-Boost Immunization Regimen in Mice Results in Long-Term HIV-1 Neutralizing Humoral Mucosal and Systemic Immunity J. Immunol., December 1, 2004; 173(11): 7078 - 7089. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. M. Gherardi, E. Perez-Jimenez, J. L. Najera, and M. Esteban Induction of HIV Immunity in the Genital Tract After Intranasal Delivery of a MVA Vector: Enhanced Immunogenicity After DNA Prime-Modified Vaccinia Virus Ankara Boost Immunization Schedule J. Immunol., May 15, 2004; 172(10): 6209 - 6220. [Abstract] [Full Text] [PDF] |
||||
![]() |
I. Castagliuolo, M. Sardina, P. Brun, C. DeRos, C. Mastrotto, L. Lovato, and G. Palu Clostridium difficile Toxin A Carboxyl-Terminus Peptide Lacking ADP-Ribosyltransferase Activity Acts as a Mucosal Adjuvant Infect. Immun., May 1, 2004; 72(5): 2827 - 2836. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. Kataoka, J. R. McGhee, R. Kobayashi, K. Fujihashi, S. Shizukuishi, and K. Fujihashi Nasal Flt3 Ligand cDNA Elicits CD11c+CD8+ Dendritic Cells for Enhanced Mucosal Immunity J. Immunol., March 15, 2004; 172(6): 3612 - 3619. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. S. Seaman, F. W. Peyerl, S. S. Jackson, M. A. Lifton, D. A. Gorgone, J. E. Schmitz, and N. L. Letvin Subsets of Memory Cytotoxic T Lymphocytes Elicited by Vaccination Influence the Efficiency of Secondary Expansion In Vivo J. Virol., January 1, 2004; 78(1): 206 - 215. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. P. Bradney, G. D. Sempowski, H.-X. Liao, B. F. Haynes, and H. F. Staats Cytokines as Adjuvants for the Induction of Anti-Human Immunodeficiency Virus Peptide Immunoglobulin G (IgG) and IgA Antibodies in Serum and Mucosal Secretions after Nasal Immunization J. Virol., January 15, 2002; 76(2): 517 - 524. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |