The JI
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     
 


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow Request Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Lemberg, M. K.
Right arrow Articles by Martoglio, B.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Lemberg, M. K.
Right arrow Articles by Martoglio, B.
The Journal of Immunology, 2001, 167: 6441-6446.
Copyright © 2001 by The American Association of Immunologists

Intramembrane Proteolysis of Signal Peptides: An Essential Step in the Generation of HLA-E Epitopes1

Marius K. Lemberg2,*, Felicity A. Bland2,{dagger}, Andreas Weihofen*, Veronique M. Braud3,{dagger} and Bruno Martoglio4,*

* Institute of Biochemistry, Swiss Federal Institute of Technology (Eidgenössiche Technische Hochschule), Zurich, Switzerland; and {dagger} Medical Research Council, Human Immunology Unit, Institute of Molecular Medicine, John Radcliffe Hospital, Oxford, United Kingdom


    Abstract
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Signal sequences of human MHC class I molecules are a unique source of epitopes for newly synthesized nonclassical HLA-E molecules. Binding of such conserved peptides to HLA-E induces its cell surface expression and protects cells from NK cell attack. After cleavage from the pre-protein, we show that the liberated MHC class I signal peptide is further processed by signal peptide peptidase in the hydrophobic, membrane-spanning region. This cut is essential for the release of the HLA-E epitope-containing fragment from the lipid bilayer and its subsequent transport into the lumen of the endoplasmic reticulum via the TAP.


    Introduction
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
The MHC class I molecules HLA-A, -B, -C, and -G are expressed with a typical signal sequence for targeting to the secretory pathway. Their signal sequences contain a highly conserved segment that is eventually presented at the cell surface by the nonpolymorphic nonclassical MHC class I molecule HLA-E (1, 2). There, the HLA-E-peptide complexes can bind to CD94/NKG2A receptors on NK cells and inhibit NK cell-mediated lysis (3, 4, 5). Cells that fail to express MHC class I molecules on the cell surface, e.g., certain virus-infected cells and tumor cells, are thought to be eliminated by NK cells (6). Thus, via the signal peptide fragment, HLA-E-peptide complexes indirectly report the expression level of numerous polymorphic MHC class I molecules and provide an additional level of control to the direct recognition of surface class I molecules by the killer Ig-like receptors on NK cells (7).

The pathway that yields HLA-E-binding epitopes derived from MHC class I signal sequences is not known. During translocation of proteins through the translocons at the endoplasmic reticulum (ER)5 membrane, signal sequences are usually cleaved off from the pre-protein by signal peptidase (8). At this stage, some liberated signal peptides are thought to span the ER membrane at their central hydrophobic region, with the N terminus facing the cytosol and the C terminus exposed toward the ER lumen (9). The conserved HLA-E binding epitope of polymorphic MHC class I molecules is located in the N-terminal portion of their signal sequences (see Fig. 1GoA). We therefore hypothesized that the liberated N-terminal MHC class I signal peptides are initially released from the ER membrane toward the cytosol. This model would fit with the requirement of a functional TAP transporter for HLA-E cell surface expression (2, 10).



View larger version (43K):
[in this window]
[in a new window]
 
FIGURE 1. Processing of the HLA-A*0301 signal peptide. A, Signal sequences of HLA-A*0301 and p-Prl. The hydrophobic regions are underlined; arrows indicate the signal peptidase (SPase) and approximate SPPase cleavage sites; the HLA-E binding epitope is shaded. B, In vitro translation of mRNA coding for the signal sequence plus 100 aa residues of HLA-A*0301 (HLA-A/124; lane 1) in the presence of ER-derived microsomes (lanes 2–5) and (Z-LL)2-ketone (lanes 3–5). After translation, microsomes were extracted with 500 mM KOAc and recovered by centrifugation through a sucrose cushion. One aliquot of microsomes was extracted with sodium carbonate and separated into pellet (Pel, lane 4) and supernatant (Sup, lane 5). Dots indicate the signal peptides (SP); lane 6 shows in vitro-translated reference signal peptide. C, Signal peptide processing with detergent-solubilized ER membrane proteins. In vitro-translated signal peptide of HLA-A*0301 (lanes 1–3) and SPext (MGKNSKVAVMAPRTLLLLLSGALALTQTWA) (lanes 4–6) were incubated with detergent-solubilized microsomal membrane proteins (lanes 2, 3, 5, and 6) in the presence of (Z-LL)2-ketone (lanes 3 and 6). The asterisk indicates the N-terminal signal peptide fragment (SPFext); lane 7, in vitro-translated reference peptide corresponding to the N-terminal 20 residues of SPext.

 
Using an in vitro system, we previously reported that the liberated signal peptide of the hormone preprolactin (p-Prl) is processed within the hydrophobic portion by a signal peptide peptidase (SPPase) (11). This cut was found to be critical for the release of the N-terminal signal peptide portion from the membrane toward the cytosol. In this study, we show in vitro and in living cells that intramembrane proteolysis of MHC class I signal peptides by SPPase is essential for the generation of HLA-E-binding epitopes.


    Materials and Methods
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Plasmid construction

The SalI/HindIII fragment of pBK-CMV/HLA-A*0301 was transferred into pSV-Sport1 (Life Technologies, Carlsbad, CA) under the control of the SP6 promoter to give pSV-Sport1/HLA-A*0301. To generate the signal sequence mutant (HLA-Aspmt, see Fig. 2Go for sequence), codons 14, 15, 16, 18, and 20 of the coding region were exchanged by the Quick Change Site-Directed Mutagenesis kit (Stratagene, La Jolla, CA) using the sense primer 5'-CTCCTCCTGCTACTCGTGGTGCTCCTGCTCCTGCGCCAGACCTGGGCGGG-3' and the antisense primer 5'-CCCGCCCAGGTCTGGCGCAGGAGCAGGAGCACCACGAGTAGCAGGAGGAG-3'. It resulted in pSV-Sport1/HLA-Aspmt. To generate a mutant of HLA-A*0301 with an extended signal peptide (HLA-Aspext, see Fig. 1Go for sequence) the coding region of pSV-Sport1/HLA-A*0301 was amplified by PCR using the sense primer 5'-AGTCAGGTCGACCATGGGCAAGAACAGCAAGGTGGCCGTCATGGCGCCCCG-3', which included a SalI restriction site and codons for the six additional amino acids (underlined). A standard T7 primer was used as reverse primer. The SalI/HindIII fragment of the resulting PCR product was transferred into pSV-Sport1 to generate pSV-Sport1/HLA-Aspext. For stable transfections, the insert of pSV-Sport1/HLA-Aspmt was subcloned into the BamHI restriction site of pCDNA3 (Invitrogen, San Diego, CA).



View larger version (57K):
[in this window]
[in a new window]
 
FIGURE 2. SPPase cleavage-deficient mutant of HLA-A*0301 (HLA-Aspmt). A, Signal sequence of HLA-Aspmt. Mutated amino acid residues are indicated in bold. B, In vitro translation of mRNA coding for the N-terminal 124 aa of HLA-Aspmt (lane 1) in the presence of microsomes (lanes 2-5) and (Z-LL)2-ketone (lane 3) as described in Fig. 1Go legend. One aliquot of microsomes was extracted with sodium carbonate and separated into pellet (Pel, lane 4) and supernatant (Sup, lane 5). Dots indicate the signal peptide (SP); lane 6 shows in vitro-translated reference signal peptide.

 
In vitro transcription, translation, and signal peptide processing

To prepare mRNA coding for HLA-A*0301/124, HLA-Aspmt/124, and the signal peptides of HLA-A*0301, HLA-Aspmt, and HLA- Aspext, the respective coding region was amplified with PCR using Pfu DNA polymerase (Stratagene), SP6 primer, and a reverse primer, starting with 5'-NNNNNNNNNCTA, to introduce a TAG stop codon at the desired position. PCR-amplified DNA fragments were transcribed in vitro with SP6 RNA polymerase at 42°C in the presence of 500 µM m7G(5')ppp(5')G CAP analog (New England Biolabs, Beverly, MA) (12).

Translations of mRNA coding for HLA-A*0301/124 and HLA-Aspmt/124 were performed in 25 µl of reticulocyte lysate (Promega, Madison, WI) containing [35S]methionine (Amersham Pharmacia Biotech, Little Chalfont, U.K.) and, where indicated, two equivalents of nuclease treated rough microsomes prepared from dog pancreas and N-glycosylation inhibitor N-benzoyl-Asn-Leu-Thr-methyamide (13) and 5 µM (Z-LL)2-ketone (11). Samples were incubated for 15 min at 30°C. Microsomes were extracted with 500 mM KOAc and prepared for SDS-PAGE as described previously (11). For extraction with alkali, KOAc-extracted microsomes were treated with 100 mM Na2CO3, pH 11.3 (13). Translations of mRNA coding for the signal peptides were translated in 25 µl of wheat germ extract at 25°C for 15 min (13).

Signal peptide processing with 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate-solubilized microsomal membrane proteins was performed as described elsewhere (11), except that the signal peptidase inhibitor N-methoxysuccinyl-Ala-Ala-Pro-Val-chloromethyl ketone (250 µM; Sigma-Aldrich, St. Louis, MO) was added to the reaction mixture to prevent cleavage of the HLA-A signal peptides at a cryptic signal peptidase cleavage site.

Electrophoresis

Proteins and peptides were analyzed by SDS-PAGE using Tris-bicine gels (14). Membrane pellets and proteins precipitated with (NH4)2SO4 or trichloroacetic acid were dissolved in sample buffer containing 360 mM bis-Tris, 160 mM bicine, 1% SDS, 50 mM DTT, 15% sucrose, and 0.004% Serva blue. All samples were incubated for 15 min at 65°C. Proteins were finally separated on 15% T, 5% C, 8 M urea acrylamide gels (70 x 80 x 1 mm). Labeled proteins were visualized by a STORM PhosphorImager (Molecular Dynamics, Sunnyvale, CA).

HLA-E cell surface expression

To prepare stably transfected cells expressing mutant HLA-A*0301 (HLA-Aspmt), 721.221 were electroporated with 30 µg of the respective plasmid DNA at 270 V with a capacitance of 1500 µF (15). Stable transfected clones were obtained after 3 wk. Surface expression of HLA-A*0301 and HLA-E was monitored by flow cytometry using GAP-A3 and DT9 Abs followed by PE-labeled anti-mouse (Fab')2 (Sigma-Aldrich) (2).

TAP transport

721.221 cells were permeabilized according to Jadot et al. (16), except that digitonin (0.006%) was used instead of saponin. For TAP transport (17), 3 x 105 permeabilized cells were incubated in 25 µl of 50 mM HEPES-KOH (pH 7.6), 150 mM KOAc, 5 mM Mg(OAc)2, 250 mM sucrose, and 1 mM DTT, and 60 nM 125I-labeled RRYQNSTEL (9 Ci/mmol) and 2 µl of ATP mix (12.5 mM ATP, 3.5 U/µl creatine kinase, and 110 mM creatine phosphate). ATP was depleted by the addition of 0.3 U of hexokinase and 20 µmol of glucose during the assay. After the reaction, salt concentration was raised to 500 mM KOAc, and cells were separated by a 3-min centrifugation through a 100-µl sucrose cushion (50 mM HEPES-KOH (pH 7.6), 500 mM KOAc, 2 mM MgOAc2, and 500 mM sucrose) at 48,000 rpm and 4°C in a Beckman TLA100 rotor (Beckman Coulter, Fullerton, CA). 125I-Labeled peptide in the membrane fraction was quantified by gamma-counting and analyzed by SDS-PAGE as previously described (11). All values were determined by three independent assays.

Peptide binding to HLA-E

HLA-E-binding assays were conducted as described previously (1). 721.221 cells were starved for 60 min in methionine-free medium followed by labeling with 100 µCi of [35S]methionine (Amersham Pharmacia Biotech.) per 107 cells for 1 h. Cells were then washed in ice-cold PBS and lysed for 20 min at 4°C in lysis buffer (40 mM Tris-HCl (pH 7.6), 5 mM EDTA, 150 mM NaCl, 0.5% Nonidet P-40, 5 mM iodoacetamide, and 2 mM PMSF) in the presence or absence of the indicated concentrations of peptide or with the conformation-dependent Ab W6/32. Supernatants were heated for 2 min at 44°C before preclearing by the addition of 10% Staphylococcus aureus cells (Pansorbin; Calbiochem, San Diego, CA) overnight. Peptide-HLA-E complexes were recovered by immunoprecipitation using W6/32 and protein A-Sepharose beads (Sigma-Aldrich). Samples were analyzed by 1D-IEF (18) followed by autoradiography. Peptide binding was quantified by densitometry of the HLA-E H chain band using a FLA-2000 Image Analyzer (Raytek Scientific, Sheffield, U.K.). Results are expressed as a ratio of ODs (ODpeptide - ODPBS/ODW6/32 - ODPBS) x 100 and referred to as a percentage of binding to HLA-E. Each peptide was tested in three independent assays.


    Results
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
The signal peptide of classical MHC class I molecules is processed by SPPase

Although MHC class I molecules are highly polymorphic, their signal sequences are relatively conserved. This is consistent with their role in providing a conserved peptide to HLA-E. To characterize how these peptides are generated, we investigated in vitro the fate of a representative MHC class I molecule, HLA-A*0301. mRNA coding for the signal sequence plus 100 additional residues of HLA-A*0301 (HLA-A/124) was translated in reticulocyte lysates in the presence of ER-derived rough microsomes (Fig. 1GoB). Microsomes were subsequently isolated and analyzed for [35S]methionine-labeled translation products. As expected, HLA-A/124 was translocated into the microsomes and yielded HLA-A/100 after cleavage of the signal sequence (Fig. 1GoB, lane 2). The 24-residue-long signal peptide was not found in the membrane fraction, suggesting it had been further processed.

We have recently reported that in vitro the liberated signal peptide of p-Prl was rapidly processed by SPPase, and signal peptide fragments were released from the membrane. However, when SPPase was inhibited by the new specific inhibitor (Z-LL)2-ketone, the unprocessed signal peptide remained associated with the microsomes (11). To test whether SPPase was also involved in the processing of MHC signal sequences, the SPPase inhibitor was added to a reaction with HLA-A/124. The signal peptide of HLA-A*0301 was found to be associated with the microsomes in the presence of the SPPase inhibitor (Fig. 1GoB, lane 3). Extraction with sodium carbonate revealed a tight interaction of the signal peptide with the lipid bilayer similar to typical transmembrane proteins (Fig. 1GoB, lanes 4 and 5) (19). These findings indicate that the HLA-A*0301 signal peptide liberated from the pre-protein is further processed by SPPase, inducing the release of signal peptide fragments from the membrane.

In an attempt to locate the SPPase cleavage site, a protease assay was performed with in vitro-translated signal peptide and detergent-solubilized, partially purified SPPase (11). The HLA-A*0301 signal peptide was cleaved (Fig. 1GoC, lane 2), but cleavage products were not detected, most likely because the expected short peptide could not be fixed on the gel. When (Z-LL)2-ketone was added, processing of the signal peptide was inhibited (Fig. 1GoC, lane 3). To identify cleavage products on the gel, an extended signal peptide (SPext) with six additional residues (MGKNSKVAVM...) at the N terminus was applied in the assay. SPext was processed by SPPase like the wild-type (wt) signal peptide (Fig. 1GoC, lane 5). The observed cleavage product, which was labeled by the methionine residues in the N-terminal portion, had an electrophoretic mobility similar to a peptide corresponding to the N-terminal 20 residues of SPext (Fig. 1GoC, lane 7). This result indicates that SPPase cleaves the peptide in the center of the hydrophobic region where the helix-breaking serine and glycine residues are located (Fig. 1GoA). The result is consistent with the previous finding that the signal peptide of p-Prl is cleaved by SPPase in the center of the hydrophobic region at the helix-breaking serine and asparagine residues (Fig. 1GoA) (11).

The generation of HLA-E epitopes requires signal peptide processing by SPPase

To test whether signal peptide processing by SPPase is an essential step in HLA-E epitope generation, we prepared an HLA-A*0301 signal sequence mutant (HLA-Aspmt) that cannot be processed by SPPase. Systematic studies with p-Prl and HLA-A*0301 signal sequence mutants revealed that positively charged residues flanking the hydrophobic core inhibit signal peptide processing, and central helix-breaking residues are essential for proteolysis in the transmembrane region (M. K. Lemberg and B. Martoglio, unpublished data). The helix-breaking motif in the center and the small residues in the C-terminal portion of the hydrophobic region were therefore replaced by amino acids with long hydrophobic side chains and an arginine was introduced at the end (Fig. 2GoA). In the in vitro translation/translocation experiment, HLA-Aspmt/124 was translocated into microsomes and cleaved by signal peptidase like wt HLA-A/124 (Fig. 2GoB, lane 2). However, the liberated signal peptide of HLA-Aspmt was not processed by SPPase and remained entirely associated with the membrane in a carbonate-resistant manner (Fig. 2GoB, lanes 2–5).

To test whether the mutation of the HLA-A*0301 signal sequence affects HLA-E cell surface expression, the HLA-A-, -B-, -C-, and -G-negative cells 721.221 were stably transfected and selected to express an identical level of either wt HLA-A*0301 or mutant HLA-Aspmt (Fig. 3Go) (20). HLA-E surface expression, as measured by flow cytometry using the mAb DT9 (2), was only observed with cells expressing wt HLA-A*0301 (Fig. 3Go). HLA-E surface expression could not be detected with cells expressing HLA-Aspmt, whose signal peptide cannot be processed by SPPase (Fig. 3Go). Cleavage by SPPase in the C-terminal portion of the hydrophobic region is therefore essential for the generation of HLA-E-binding epitopes.



View larger version (20K):
[in this window]
[in a new window]
 
FIGURE 3. Processing of the HLA-A*0301 signal peptide by SPPase is essential for HLA-E cell surface expression. 721.221 cells were stably transfected with HLA-A*0301 or HLA-Aspmt. Cell surface expression of HLA-E and HLA-A*0301 were monitored by flow cytometry using the mAbs DT9 and GAP-A3, respectively. Anti-trinitrophenol Abs were used as control.

 
N-terminal signal peptide fragments are substrates for TAP

HLA-E presents nonameric peptides derived from the signal sequence of classical HLA molecules, e.g., residues -22 to -14 of HLA-A*0301 (Fig. 1GoA) (1, 2, 10). To generate the nonamer from the ~14-residue-long N-terminal signal peptide fragment produced by SPPase, the N and C termini have to be trimmed either before or after the peptide binds to HLA-E. HLA-E expression has been found to be TAP dependent (2, 10), suggesting that the N-terminal signal peptide portion of HLA-A*0301 is released toward the cytosol.

To assess where the trimming occurs, a series of truncated N-terminal HLA-A*0301 signal peptide fragments was synthesized and their transport by TAP and binding to HLA-E were tested. TAP transport into digitonin-permeabilized 721.221 cells was assayed using the 125I-labeled reporter peptide RRYQNSTEL with unlabeled synthetic HLA-A*0301 signal peptide fragments as competitors (Fig. 4GoA) (17). The peptide corresponding to the nonameric epitope (VMAPRTLLL) was transported most efficiently and competed transport of the reporter peptide with an IC50 value of ~0.4 µM (Fig. 4GoB). With the exception of the 14-residue-long signal peptide fragment ending with a serine, all other peptides tested were transported efficiently as well and reached IC50 values of 0.7–3 µM in the competition assay (Fig. 4GoB). The slightly reduced transport efficiency of the 14-mer (IC50 ~8 µM) is most likely due to the C-terminal serine residue, which is known to reduce the binding affinity of peptides to TAP (21, 22). These results indicate that potential N-terminal signal peptide fragments of HLA-A*0301 are all good substrates for TAP, but N- and C-terminal trimming can increase the efficiency of transport.



View larger version (38K):
[in this window]
[in a new window]
 
FIGURE 4. Transport of HLA-A*0301 signal peptide fragments by TAP. A, Permeabilized 721.221 cells were incubated with the 125I-labeled reporter peptide RRYQNSTEL in the absence (lane 2) or presence of an ATP regeneration system (lanes 3–7). Synthetic MAVMAPRTLLLLLS was added at increasing concentrations (lanes 4–7). Cells were extracted with 500 mM KOAc, separated by centrifugation, and radiolabeled peptides recovered in the pellet were analyzed by SDS-PAGE. Lane 1, Unglycosylated 125I-labeled RRYQNSTEL. B, Competition of peptide transport with MAVMAPRTLLLLLSG (•), MAVMAPRTLLLLLS ({circ}), MAVMAPRTLLLLL ({diamondsuit}), MAVMAPRTLLLL ({diamond}), MAVMAPRTLLL ({triangledown}), and VMAPRTLLL ({triangleup}). Values of transport with ATP and without ATP, respectively, are indicated in the bar graph.

 
Efficient binding to HLA-E requires C-terminal trimming

The synthetic HLA-A*0301 signal peptide fragments were next tested for binding to HLA-E as determined by stabilization of HLA-E molecules in cell lysates (Fig. 5Go) (1). Extension by two residues at the N terminus of the nonamer peptide did not significantly affect peptide binding affinity (Fig. 5Go, peptide VII). By contrast, extension at the C terminus did. Peptides with additional residues at the C terminus bound to HLA-E at 30 µM as previously shown (1). However, binding at the lower concentrations of 3 and 0.3 µM (Fig. 5GoB, peptides III–VI) was not significantly higher than binding of the negative control VTAPRTLLL, the epitope known to fail to up-regulate HLA-E at the cell surface (Fig. 5Go, peptide II) (1, 2). These results show that the expected 14-residue-long N-terminal HLA-A*0301 signal peptide fragment produced by SPPase has to be trimmed at its C terminus for efficient binding to HLA-E. Nevertheless, because the nontrimmed peptide can bind to HLA-E with low affinity, it remains open, whether some trimming can occur after binding and during transport of the peptide-HLA-E complex to the cell surface, as it was described for other MHC class I Ags (23).



View larger version (53K):
[in this window]
[in a new window]
 
FIGURE 5. Binding of HLA-A*0301 signal peptide fragments to HLA-E is greatly increased when the correct C terminus is present. 721.221 cell lysates were incubated with PBS or peptide. Upon heating to 44°C, stabilized peptide-HLA-E complexes were isolated by immunoprecipitation with the conformation-dependent Ab W6/32. For the positive control, cell lysates were incubated in the presence of W6/32, and HLA-E stabilized by the Ab was recovered by immunoprecipitation upon heating. Analysis was by 1D-IEF (an example is shown in A for peptides I and VII). Each peptide was tested in three independent assays. A, Extension of the nonamer peptide at the N terminus (peptide VII, MAVMAPRTLLL) does not significantly affect binding to HLA-E when compared with the optimal nonamer peptide (peptide I, VMAPRTLLL). B, Peptide titrations of N-terminal HLA-A*0301 signal peptide fragments binding to HLA-E. The data obtained from peptides I and VII, as shown in A is represented alongside the data of peptides II–VI: I, VMAPRTLLL; II, VTAPRTLLL; III, MAVMAPRTLLLLLSG; IV, MAVMAPRTLLLLLS; V, MAVMAPRTLLLLL; VI, MAVMAPRTLLLL; and VII, MAVMAPRTLLL. Percentage of binding was calculated as a ratio of ODs normalized to bindingwith W6/32.

 

    Discussion
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
The present study identifies signal peptide processing by SPPase as a new and essential step in the generation of HLA-E-binding epitopes derived from the signal sequence of polymorphic MHC class I molecules. Proteolysis by SPPase in the transmembrane region of signal peptides promotes the release of the fragment containing the epitope from the ER membrane. The resulting signal peptide fragments can then be transported into the ER lumen by TAP and subsequently bind to HLA-E, which, in turn, is transported to the cell surface and presents the epitope to CD94/NKG2 receptors on NK cells.

The functions of a signal sequence in protein targeting and membrane insertion are well established (24) but the fate of signal peptides after they have been cleaved off from the pre-protein by signal peptidase is hardly understood (25). As shown here in the in vitro translation/translocation system, the liberated signal peptide is anchored in the microsomal membrane in a carbonate-resistant manner, like a membrane protein. Cleavage within the hydrophobic transmembrane region by the SPPase promotes the release of signal peptide fragments from the lipid bilayer. This mechanism is reminiscent of the regulated intramembrane proteolysis described for an increasing number of eukaryotic or prokaryotic membrane proteins involved in a variety of cellular pathways (for review, see Refs. 26, 27).

In higher organisms, MHC class I molecules present 8–10 residue peptides on the surface of virtually every nucleated cell, where they can serve as target Ags for cytotoxic T lymphocytes (28). The major proteolytic activities required for the generation of these peptides are the proteasome in the cytosol for protein fragmentation, and in some cases aminopeptidases in the cytosol or ER lumen for peptide trimming (29, 30, 31, 32, 33, 34). Although it is possible to prevent the generation of most epitopes through the use of proteasome inhibitors (35, 36), others remain resistant to their effects. This suggested that nonproteasomal proteases might be responsible for the generation of a fraction of MHC class I ligands (37, 38, 39). It is speculated that the proteasome is not involved in the generation of HLA-E-binding peptides, as far as it can be deduced from experiments with the mouse functional homologue of HLA-E, Qa-1 (40). However, we show that the SPPase is required to release the peptide fragment containing the HLA-E epitope from the ER membrane. The peptide requires further trimming at both N and C termini to produce the nonamer epitope. Because extension at the C terminus dramatically reduces the peptide-binding affinity to HLA-E, it is likely that C-terminal trimming occurs in the cytosol. This would be consistent with previous reports suggesting that the generation of the Qdm peptide binding to Qa-1 involves cytosolic C-terminal trimming (41) and that ER-resident proteases can trim peptides at their N terminus and not at the C terminus (31, 32, 33, 36, 42). Conversely, N-terminal trimming could occur in the cytosol or the ER and may even take place after binding of the peptide to HLA-E since N-terminal extensions do not appear to affect peptide binding (30, 31, 32, 33, 36, 43).

TAP is also required for the cell surface expression of signal peptide-derived HLA-E epitopes (2, 10). TAP dependency is consistent with the results presented here, which indicate that SPPase promotes the release of the epitope-containing signal peptide portion from the ER membrane toward the cytosol. SPPase apparently produces TAP substrates from membrane-anchored signal peptides in analogy to the proteasome, which produces TAP substrates from cytosolic proteins (29). The generation of MHC class I epitopes via signal peptide processing may thus be an alternative route to the more common proteasome-dependent pathway of epitope production, and may guarantee a close correlation between the number of HLA-E-peptide complexes and synthesized MHC class I molecules. One aspect that still needs to be investigated is whether SPPase can generate both TAP-dependent and TAP-independent signal peptide fragments capable of binding to MHC class I molecules. Interestingly, removing the charged residue (Arg at position 7) in the N-terminal region of the mouse HLA class I signal sequence alters its insertion and induces TAP-independent presentation of the Qdm peptide (41, 44). The human cytomegalovirus glycoprotein UL40 (HCMV gpUL40) also provides such signal peptide in a TAP-independent manner (45, 46). Preliminary studies have however ruled out a role for SPPase in its generation (V. M. Braud, B. Martoglio, and collaborators, manuscript in preparation). It also remains to determine whether SPPase cleaves only a discrete number of signal peptides, which may have specific properties and functions beyond processing, or whether signal peptide processing is part of a default pathway to clear the ER membrane from the unwanted peptides by analogy to the involvement of the proteasome in the clearance of defective ribosomal products (47). The latter function seems more likely, but stresses the question of the fate of the released peptides. Are signal peptide fragments released into the cytosol generally substrates for TAP, as proposed above, or are they substrates for cytosolic proteases? Is there a selection, for example, HLA-E epitope-containing peptides and how are liberated signal peptides protected from degradation? One can speculate that chaperone molecules may be involved in such a process (25). Clearly the detailed characterization of the SPPase responsible for the cleavage of signal sequences and its role in peptide fragmentation and epitope generation will be a challenge for the future.


    Acknowledgments
 
We thank N. Cereb, S. Y. Yang, and M. Colonna for the plasmid pBK-CMV/HLA-A*0301; K. Di Gleria for the synthesis of peptides; and M. F. van den Broek, P. Kreci, and C. Aeberle for iodination of RRYQNSTEL. We also acknowledge the critical discussions with A. Helenius, A. Williams, and C. A. Peh.


    Footnotes
 
1 This work was supported by grants from Eidgenössiche Technische Hochschule, Zurich and the Swiss National Science Foundation (to B.M.) and the Medical Research Council (to F.A.B.). V.M.B. was a Royal Society University Research Fellow. Back

2 M.K.L. and F.A.B. contributed equally to this work. Back

3 Current address: Institut de Pharmacologie Moléculaire et Cellulaire, Centre National de la Recherche Scientifique, 06560 Valbonne, France. Back

4 Address correspondence and reprint requests to Dr. Bruno Martoglio, Institute of Biochemistry, Swiss Federal Institute of Technology (Eidgenössiche Technische Hochschule), 8092 Zurich, Switzerland. E-mail address: bruno.martoglio{at}bc.biol.ethz.ch Back

5 Abbreviations used in this paper: ER, endoplasmic reticulum; p-Prl, preprolactin; SPPase, signal peptide peptidase; wt, wild type. Back

Received for publication August 1, 2001. Accepted for publication October 4, 2001.


    References
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 

  1. Braud, V., E. Y. Jones, A. McMichael. 1997. The human major histocompatibility complex class Ib molecule HLA-E binds signal sequence-derived peptides with primary anchor residues at positions 2 and 9. Eur. J. Immunol. 27:1164.[Medline]
  2. Braud, V. M., D. S. J. Allan, D. Wilson, A. J. McMichael. 1998. TAP- and tapasin-dependent HLA-E surface expression correlates with the binding of an MHC class I leader peptide. Curr. Biol. 8:1.[Medline]
  3. Braud, V. M., D. S. J. Allan, C. A. O’Callaghan, K. Soderstrom, A. D’Andrea, G. S. Ogg, S. Lazetic, N. T. Young, J. I. Bell, J. H. Phillips, et al 1998. HLA-E binds to natural killer cell receptors CD94/NKG2A, B and C. Nature 391:795.[Medline]
  4. Borrego, F., M. Ulbrecht, E. H. Weiss, J. E. Coligan, A. G. Brooks. 1998. Recognition of human histocompatibility leukocyte antigen (HLA)-E complexed with HLA class I signal sequence-derived peptides by CD94/NKG2 confers protection from natural killer cell-mediated lysis. J. Exp. Med. 187:813.[Abstract/Free Full Text]
  5. Lee, N., M. Llano, M. Carretero, A. Ishitani, F. Navarro, M. Lopez-Botet, D. E. Geraghty. 1998. HLA-E is a major ligand for the natural killer inhibitory receptor CD94/NKG2A. Proc. Natl. Acad .Sci. USA 95:5199.[Abstract/Free Full Text]
  6. Ljunggren, H. G., K. Karre. 1990. In search of the "missing self": MHC molecules and NK cell recognition. Immunol. Today 11:237.[Medline]
  7. Lanier, L. L.. 1998. NK cell receptors. Annu. Rev. Immunol. 16:359.[Medline]
  8. Blobel, G., B. Dobberstein. 1975. Transfer of proteins across membranes. I. Presence of proteolytically processed and unprocessed nascent immunoglobulin light chains on membrane-bound ribosomes of murine myeloma. J. Cell Biol. 67:835.[Abstract/Free Full Text]
  9. Paetzel, M., R. E. Dalbey, N. C. Strynadka. 1998. Crystal structure of a bacterial signal peptidase in complex with a {beta}-lactam inhibitor. Nature 396:186.[Medline]
  10. Lee, N., D. R. Goodlett, A. Ishitani, H. Marquardt, D. E. Geraghty. 1998. HLA-E surface expression depends on binding of TAP-dependent peptides derived from certain HLA class I signal sequences. J. Immunol. 160:4951.[Abstract/Free Full Text]
  11. Weihofen, A., M. K. Lemberg, H. L. Ploegh, M. Bogyo, B. Martoglio. 2000. Release of signal peptide fragments into the cytosol requires cleavage in the transmembrane region by a protease activity that is specifically blocked by a novel cysteine protease inhibitor. J. Biol. Chem. 275:30951.[Abstract/Free Full Text]
  12. Nilsson, I. M., G. von Heijne. 1993. Determination of the distance between the oligosaccharyltransferase active site and the endoplasmic reticulum membrane. J. Biol. Chem. 268:5798.[Abstract/Free Full Text]
  13. Martoglio, B., S. Hauser, B. Dobberstein. 1998. Cotranslational translocation of proteins into microsomes derived from the rough endoplasmic reticulum of mammalian cells. J. E. Celis, ed. In Cell Biology: A Laboratory Handbook Vol. 2:265. Academic, San Diego, CA.
  14. Wiltfang, J., A. Smirnov, B. Schnierstein, G. Kelemen, U. Matthies, H. W. Klafki, M. Staufenbiel, G. Huther, E. Ruther, J. Kornhuber. 1997. Improved electrophoretic separation and immunoblotting of {beta}-amyloid (A{beta}) peptides 1–40, 1–42, and 1–43. Electrophoresis 18:527.[Medline]
  15. Brielmeier, M., J. M. Bechet, M. H. Falk, M. Pawlita, A. Polack, G. W. Bornkamm. 1998. Improving stable transfection efficiency: antioxidants dramatically improve the outgrowth of clones under dominant marker selection. Nucleic Acids Res. 26:2082.[Abstract/Free Full Text]
  16. Jadot, M., M. W. Hofmann, R. Graf, H. Quader, B. Martoglio. 1995. Protein insertion into the endoplasmic reticulum of permeabilized cells. FEBS Lett. 371:145.[Medline]
  17. Neefjes, J. J., F. Momburg, G. J. Hammerling. 1993. Selective and ATP-dependent translocation of peptides by the MHC-encoded transporter. [Published erratum appears in 1994 Science 264:16.]. Science 261:769.[Abstract/Free Full Text]
  18. Neefjes, J. J., I. Doxiadis, N. J. Stam, C. J. Beckers, H. L. Ploegh. 1986. An analysis of class I antigens of man and other species by one-dimensional IEF and immunobloting. Immunogenetics 23:164.[Medline]
  19. Fujiki, Y., A. L. Hubbard, S. Fowler, P. B. Lazarow. 1982. Isolation of intracellular membranes by means of sodium carbonate treatment: application to endoplasmic reticulum. J. Cell Biol. 93:97.[Abstract/Free Full Text]
  20. Adam, S. A., T. Nakagawa, M. S. Swanson, T. K. Woodruff, G. Dreyfuss. 1986. mRNA polyadenylate-binding protein: gene isolation and sequencing and identification of a ribonucleoprotein consensus sequence. Mol. Cell. Biol. 6:2932.[Abstract/Free Full Text]
  21. Uebel, S., W. Kraas, S. Kienle, K. H. Wiesmuller, G. Jung, R. Tampe. 1997. Recognition principle of the TAP transporter disclosed by combinatorial peptide libraries. Proc. Natl. Acad. Sci. USA 94:8976.[Abstract/Free Full Text]
  22. Daniel, S., V. Brusic, S. Caillat-Zucman, N. Petrovsky, L. Harrison, D. Riganelli, F. Sinigaglia, F. Gallazzi, J. Hammer, P. M. van Endert. 1998. Relationship between peptide selectivities of human transporters associated with antigen processing and HLA class I molecules. J. Immunol. 161:617.[Abstract/Free Full Text]
  23. Gil-Torregrosa, B. C., A. Raul Castano, M. Del Val. 1998. Major histocompatibility complex class I viral antigen processing in the secretory pathway defined by the trans-Golgi network protease furin. J. Exp. Med. 188:1105.[Abstract/Free Full Text]
  24. Walter, P., A. E. Johnson. 1994. Signal sequence recognition and protein targeting to the endoplasmic reticulum membrane. Annu. Rev. Cell Biol. 10:87.
  25. Martoglio, B., B. Dobberstein. 1998. Signal sequences: more than just greasy peptides. Trends Cell Biol. 8:410.[Medline]
  26. Brown, M. S., J. Ye, R. B. Rawson, J. L. Goldstein. 2000. Regulated intramembrane proteolysis: a control mechanism conserved from bacteria to humans. Cell 100:391.[Medline]
  27. Hoppe, T., M. Rape, S. Jentsch. 2001. Membrane-bound transcription factors: regulated release by RIP or RUP. Curr. Opin. Cell Biol. 13:344.[Medline]
  28. York, I. A., A. L. Goldberg, X. Y. Mo, K. L. Rock. 1999. Proteolysis and class I major histocompatibility complex antigen presentation. Immunol. Rev. 172:49.[Medline]
  29. Pamer, E., P. Cresswell. 1998. Mechanisms of MHC class I-restricted antigen processing. Annu. Rev. Immunol. 16:323.[Medline]
  30. Stoltze, L., M. Schirle, G. Schwarz, C. Schroter, M. W. Thompson, L. B. Hersh, H. Kalbacher, S. Stevanovic, H. G. Rammensee, H. Schild. 2000. Two new proteases in the MHC class I processing pathway. Nat. Immunol. 1:413.[Medline]
  31. Serwold, T., S. Gaw, N. Shastri. 2001. ER aminopeptidases generate a unique pool of peptides for MHC class I molecules. Nat. Immunol. 2:644.[Medline]
  32. Menoret, A., M. L. Niswonger, A. Altmeyer, P. K. Srivastava. 2001. An ER protein implicated in chaperoning peptides to MHC class I is an aminopeptidase. J. Biol. Chem. 7:7.
  33. Komlosh, A., F. Momburg, T. Weinschenk, N. Emmerich, H. Schild, E. Nadav, I. Shaked, Y. Reiss. 2001. A role for a novel lumenal endoplasmic reticulum aminopeptidase in final trimming of 26S proteasome-generated major histocompatibility complex class I antigenic peptides. J. Biol. Chem. 23:23.
  34. Cascio, P., C. Hilton, A. F. Kisselev, K. L. Rock, A. L. Goldberg. 2001. 26S proteasomes and immunoproteasomes produce mainly N-extended versions of an antigenic peptide. EMBO J. 20:2357.[Medline]
  35. Benham, A. M., M. Gromme, J. Neefjes. 1998. Allelic differences in the relationship between proteasome activity and MHC class I peptide loading. J. Immunol. 161:83.[Abstract/Free Full Text]
  36. Rock, K. L., A. L. Goldberg. 1999. Degradation of cell proteins and the generation of MHC class I-presented peptides. Annu. Rev. Immunol. 17:739.[Medline]
  37. Glas, R., M. Bogyo, J. S. McMaster, M. Gaczynska, H. L. Ploegh. 1998. A proteolytic system that compensates for loss of proteasome function. Nature 392:618.[Medline]
  38. Luckey, C. J., G. M. King, J. A. Marto, S. Venketeswaran, B. F. Maier, V. L. Crotzer, T. A. Colella, J. Shabanowitz, D. F. Hunt, V. H. Engelhard. 1998. Proteasomes can either generate or destroy MHC class I epitopes: evidence for nonproteasomal epitope generation in the cytosol. J. Immunol. 161:112.[Abstract/Free Full Text]
  39. Geier, E., G. Pfeifer, M. Wilm, M. Lucchiari-Hartz, W. Baumeister, K. Eichmann, G. Niedermann. 1999. A giant protease with potential to substitute for some functions of the proteasome. Science 283:978.[Abstract/Free Full Text]
  40. Bai, A., J. Forman. 1997. The effect of the proteasome inhibitor lactacystin on the presentation of transporter associated with antigen processing (TAP)-dependent and TAP-independent peptide epitopes by class I molecules. J. Immunol. 159:2139.[Abstract/Free Full Text]
  41. Bai, A., C. J. Aldrich, J. Forman. 2000. Factors controlling the trafficking and processing of a leader-derived peptide presented by Qa-1. J. Immunol. 165:7025.[Abstract/Free Full Text]
  42. Mo, X. Y., P. Cascio, K. Lemerise, A. L. Goldberg, K. Rock. 1999. Distinct proteolytic processes generate the C and N termini of MHC class I-binding peptides. J. Immunol. 163:5851.[Abstract/Free Full Text]
  43. Beninga, J., K. L. Rock, A. L. Goldberg. 1998. Interferon-{gamma} can stimulate post-proteasomal trimming of the N terminus of an antigenic peptide by inducing leucine aminopeptidase. J. Biol. Chem. 273:18734.[Abstract/Free Full Text]
  44. Bai, A., J. Broen, J. Forman. 1998. The pathway for processing leader-derived peptides that regulate the maturation and expression of Qa-1b. Immunity 9:413.[Medline]
  45. Tomasec, P., V. M. Braud, C. Rickards, M. B. Powell, B. P. McSharry, S. Gadola, V. Cerundolo, L. K. Borysiewicz, A. J. McMichael, G. W. Wilkinson. 2000. Surface expression of HLA-E, an inhibitor of natural killer cells, enhanced by human cytomegalovirus gpUL40. Science 287:1031.[Abstract/Free Full Text]
  46. Ulbrecht, M., S. Martinozzi, M. Grzeschik, H. Hengel, J. W. Ellwart, M. Pla, E. H. Weiss. 2000. Cutting edge: the human cytomegalovirus UL40 gene product contains a ligand for HLA-E and prevents NK cell-mediated lysis. J. Immunol. 164:5019.[Abstract/Free Full Text]
  47. Schubert, U., L. C. Anton, J. Gibbs, C. C. Norbury, J. W. Yewdell, J. R. Bennink. 2000. Rapid degradation of a large fraction of newly synthesized proteins by proteasomes. Nature 404:770.[Medline]



This article has been cited by other articles:


Home page
J. Biol. Chem.Home page
R. Fluhrer, H. Steiner, and C. Haass
Intramembrane Proteolysis by Signal Peptide Peptidases: A Comparative Discussion of GXGD-type Aspartyl Proteases
J. Biol. Chem., May 22, 2009; 284(21): 13975 - 13979.
[Abstract] [Full Text] [PDF]


Home page
Plant Physiol.Home page
S. Han, L. Green, and D. J. Schnell
The Signal Peptide Peptidase Is Required for Pollen Function in Arabidopsis
Plant Physiology, March 1, 2009; 149(3): 1289 - 1301.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
T. Robakis, B. Bak, S.-h. Lin, D. J. Bernard, and P. Scheiffele
An Internal Signal Sequence Directs Intramembrane Proteolysis of a Cellular Immunoglobulin Domain Protein
J. Biol. Chem., December 26, 2008; 283(52): 36369 - 36376.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
T. Sato, K. Ananda, C. I. Cheng, E. J. Suh, S. Narayanan, and M. S. Wolfe
Distinct Pharmacological Effects of Inhibitors of Signal Peptide Peptidase and {gamma}-Secretase
J. Biol. Chem., November 28, 2008; 283(48): 33287 - 33295.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
F. El Hage, V. Stroobant, I. Vergnon, J.-F. Baurain, H. Echchakir, V. Lazar, S. Chouaib, P. G. Coulie, and F. Mami-Chouaib
Preprocalcitonin signal peptide generates a cytotoxic T lymphocyte-defined tumor epitope processed by a proteasome-independent pathway
PNAS, July 22, 2008; 105(29): 10119 - 10124.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
P. Targett-Adams, G. Hope, S. Boulant, and J. McLauchlan
Maturation of Hepatitis C Virus Core Protein by Signal Peptide Peptidase Is Required for Virus Production
J. Biol. Chem., June 13, 2008; 283(24): 16850 - 16859.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
E. Dultz, M. Hildenbeutel, B. Martoglio, J. Hochman, B. Dobberstein, and K. Kapp
The Signal Peptide of the Mouse Mammary Tumor Virus Rem Protein Is Released from the Endoplasmic Reticulum Membrane and Accumulates in Nucleoli
J. Biol. Chem., April 11, 2008; 283(15): 9966 - 9976.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
L. G. Iben, R. E. Olson, L. A. Balanda, S. Jayachandra, B. J. Robertson, V. Hay, J. Corradi, C. V. C. Prasad, R. Zaczek, C. F. Albright, et al.
Signal Peptide Peptidase and {gamma}-Secretase Share Equivalent Inhibitor Binding Pharmacology
J. Biol. Chem., December 21, 2007; 282(51): 36829 - 36836.
[Abstract] [Full Text] [PDF]


Home page
EndocrinologyHome page
A. Giraud, P.-J. Lejeune, J. Barbaria, and B. Mallet
A Plasminogen-Like Protease in Thyroid Rough Microsomes Degrades Thyroperoxidase and Thyroglobulin
Endocrinology, June 1, 2007; 148(6): 2886 - 2893.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
P. Targett-Adams, T. Schaller, G. Hope, R. E. Lanford, S. M. Lemon, A. Martin, and J. McLauchlan
Signal Peptide Peptidase Cleavage of GB Virus B Core Protein Is Required for Productive Infection in Vivo
J. Biol. Chem., September 29, 2006; 281(39): 29221 - 29227.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
C. Vauloup-Fellous, V. Pene, J. Garaud-Aunis, F. Harper, S. Bardin, Y. Suire, E. Pichard, A. Schmitt, P. Sogni, G. Pierron, et al.
Signal Peptide Peptidase-catalyzed Cleavage of Hepatitis C Virus Core Protein Is Dispensable for Virus Budding but Destabilizes the Viral Capsid
J. Biol. Chem., September 22, 2006; 281(38): 27679 - 27692.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
S. Boulant, R. Montserret, R. G. Hope, M. Ratinier, P. Targett-Adams, J.-P. Lavergne, F. Penin, and J. McLauchlan
Structural Determinants That Target the Hepatitis C Virus Core Protein to Lipid Droplets
J. Biol. Chem., August 4, 2006; 281(31): 22236 - 22247.
[Abstract] [Full Text] [PDF]


Home page
FASEB J.Home page
A. C. Nyborg, T. B. Ladd, K. Jansen, T. Kukar, and T. E. Golde
Intramembrane proteolytic cleavage by human signal peptide peptidase like 3 and malaria signal peptide peptidase
FASEB J, August 1, 2006; 20(10): 1671 - 1679.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
R. Matsumi, H. Atomi, and T. Imanaka
Identification of the Amino Acid Residues Essential for Proteolytic Activity in an Archaeal Signal Peptide Peptidase
J. Biol. Chem., April 14, 2006; 281(15): 10533 - 10539.
[Abstract] [Full Text] [PDF]


Home page
J. Bacteriol.Home page
R. Matsumi, H. Atomi, and T. Imanaka
Biochemical Properties of a Putative Signal Peptide Peptidase from the Hyperthermophilic Archaeon Thermococcus kodakaraensis KOD1
J. Bacteriol., October 15, 2005; 187(20): 7072 - 7080.
[Abstract] [Full Text] [PDF]


Home page
GeneticsHome page
D. J. Casso, S. Tanda, B. Biehs, B. Martoglio, and T. B. Kornberg
Drosophila Signal Peptide Peptidase Is an Essential Protease for Larval Development
Genetics, May 1, 2005; 170(1): 139 - 148.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
S. Urban and M. S. Wolfe
Reconstitution of intramembrane proteolysis in vitro reveals that pure rhomboid is sufficient for catalysis and specificity
PNAS, February 8, 2005; 102(6): 1883 - 1888.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
E. Friedmann, M. K. Lemberg, A. Weihofen, K. K. Dev, U. Dengler, G. Rovelli, and B. Martoglio
Consensus Analysis of Signal Peptide Peptidase and Homologous Human Aspartic Proteases Reveals Opposite Topology of Catalytic Domains Compared with Presenilins
J. Biol. Chem., December 3, 2004; 279(49): 50790 - 50798.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
A. P. Grigorenko, Y. K. Moliaka, M. C. Soto, C. C. Mello, and E. I. Rogaev
The Caenorhabditis elegans IMPAS gene, imp-2, is essential for development and is functionally distinct from related presenilins
PNAS, October 12, 2004; 101(41): 14955 - 14960.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
A. C. Nyborg, K. Jansen, T. B. Ladd, A. Fauq, and T. E. Golde
A Signal Peptide Peptidase (SPP) Reporter Activity Assay Based on the Cleavage of Type II Membrane Protein Substrates Provides Further Evidence for an Inverted Orientation of the SPP Active Site Relative to Presenilin
J. Biol. Chem., October 8, 2004; 279(41): 43148 - 43156.
[Abstract] [Full Text] [PDF]


Home page
ScienceHome page
M. S. Wolfe and R. Kopan
Intramembrane Proteolysis: Theme and Variations
Science, August 20, 2004; 305(5687): 1119 - 1123.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
K. Okamoto, K. Moriishi, T. Miyamura, and Y. Matsuura
Intramembrane Proteolysis and Endoplasmic Reticulum Retention of Hepatitis C Virus Core Protein
J. Virol., June 15, 2004; 78(12): 6370 - 6380.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
A. C. Nyborg, A. Y. Kornilova, K. Jansen, T. B. Ladd, M. S. Wolfe, and T. E. Golde
Signal Peptide Peptidase Forms a Homodimer That Is Labeled by an Active Site-directed {gamma}-Secretase Inhibitor
J. Biol. Chem., April 9, 2004; 279(15): 15153 - 15160.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
T. Kambayashi, J. R. Kraft-Leavy, J. G. Dauner, B. A. Sullivan, O. Laur, and P. E. Jensen
The Nonclassical MHC Class I Molecule Qa-1 Forms Unstable Peptide Complexes
J. Immunol., February 1, 2004; 172(3): 1661 - 1669.
[Abstract] [Full Text] [PDF]


Home page
Hum Mol GenetHome page
B. Martoglio and T. E. Golde
Intramembrane-cleaving aspartic proteases and disease: presenilins, signal peptide peptidase and their homologs
Hum. Mol. Genet., October 15, 2003; 12(90002): R201 - 206.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
F. A. Bland, M. K. Lemberg, A. J. McMichael, B. Martoglio, and V. M. Braud
Requirement of the Proteasome for the Trimming of Signal Peptide-derived Epitopes Presented by the Nonclassical Major Histocompatibility Complex Class I Molecule HLA-E
J. Biol. Chem., September 5, 2003; 278(36): 33747 - 33752.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
J. D. Miller, D. A. Weber, C. Ibegbu, J. Pohl, J. D. Altman, and P. E. Jensen
Analysis of HLA-E Peptide-Binding Specificity and Contact Residues in Bound Peptide Required for Recognition by CD94/NKG2
J. Immunol., August 1, 2003; 171(3): 1369 - 1375.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
A. Weihofen, M. K. Lemberg, E. Friedmann, H. Rueeger, A. Schmitz, P. Paganetti, G. Rovelli, and B. Martoglio
Targeting Presenilin-type Aspartic Protease Signal Peptide Peptidase with gamma -Secretase Inhibitors
J. Biol. Chem., May 2, 2003; 278(19): 16528 - 16533.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
D. C. Smith, A. Gallimore, E. Jones, B. Roberts, J. M. Lord, E. Deeks, V. Cerundolo, and L. M. Roberts
Exogenous Peptides Delivered by Ricin Require Processing by Signal Peptidase for Transporter Associated with Antigen Processing-Independent MHC Class I-Restricted Presentation
J. Immunol., July 1, 2002; 169(1): 99 - 107.
[Abstract] [Full Text] [PDF]


Home page
ScienceHome page
A. Weihofen, K. Binns, M. K. Lemberg, K. Ashman, and B. Martoglio
Identification of Signal Peptide Peptidase, a Presenilin-Type Aspartic Protease
Science, June 21, 2002; 296(5576): 2215 - 2218.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow Request Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Lemberg, M. K.
Right arrow Articles by Martoglio, B.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Lemberg, M. K.
Right arrow Articles by Martoglio, B.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS