|
|
||||||||


*
Department of Immunology and Cancer Center, Mayo Clinic and Mayo Graduate School, Rochester, MN 55905; and
Laboratory of Cell Biology, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892
| Abstract |
|---|
|
|
|---|
| Introduction |
|---|
|
|
|---|
The requirement for intracellular cytoplasmic processing of Ags creates some constraints for the induction of CTL responses using conventional noninfectious vaccines, such as killed pathogens or recombinant proteins. The reason is that in general APC are not very efficient in processing exogenous Ags through the MHC class I pathway. To circumvent this problem, chimeric molecules, which we call here "Trojan Ags" (TA) have been designed to deliver exogenous noninfectious material containing CTL epitopes into the cytoplasm of APC (12, 13). These TA are composed of CTL epitopes, which are linked to membrane-translocating Trojan peptides that carry these molecules across the plasma membrane into the cytoplasm (14, 15, 16, 17). The two most commonly used carriers are both highly positively charged sequences derived from the HIVtat Ag or the Antennapediahomeodomain (AntpHD) protein. It has been reported that TA are indeed capable of delivering CTL epitopes into the MHC class I pathway, enabling the efficient recognition of APC by CTL (12, 13). These studies assumed that once in the cytoplasm, the TA are processed and transported into the ER to generate the corresponding CTL epitopes. In this study, we report that TA are able to generate CTL epitopes through a TAP-independent mechanism because they have the capacity to translocate into the ER and trans-Golgi compartments, where they undergo processing. Our results show that both TAP-competent and TAP-deficient cells are equally effective in generating peptide-MHC class I complexes derived from various TA. The present findings agree with previous reports that CTL peptide epitopes can be trimmed in the ER by an aminopeptidase (6, 7, 11) or, in other cases, by furin in the trans-Golgi network (18). We believe that these findings could be of relevance for the design of CTL-inducing vaccines for the treatment or prevention of infectious and malignant diseases.
| Materials and Methods |
|---|
|
|
|---|
Synthetic TA were prepared by producing synthetic peptides containing the minimal CTL epitope joined to the HIVtat protein transduction domain (RKKRRQRRR) using a triple-alanine spacer. All synthetic peptides were synthesized according to standard solid-phase synthesis methods using an Applied Biosystems (Foster City, CA) apparatus and were purified by HPLC. The purity (>95%) and identity of peptides were determined by analytical HPLC and mass spectrometry analysis. Peptides were dissolved at 10 mg/ml in DMSO containing 0.1% trifluoroacetyl or trifluoroacetic acid and were aliquoted in small volumes to be maintained frozen at -20°C until further use.
Recombinant TA
A recombinant DNA-derived TA containing the melanoma gp100
epitope IMDQVPFSV, linked to the AntpHD translocating sequence
RQIKIWFPNRRMKWKK, was designed following a similar approach as
described by Shutze-Redelmeier et al. (12). The CTL
epitope was flanked with influenza nucleoprotein (NP) sequences,
at the N terminus (AEIDL) and at the C terminus (LRTED), to facilitate
the correct processing. To produce the final product
(RQIKIWFPNRRMKWKKAEIDLIMDQVPFSVLRTED), two synthetic
oligodeoxynucleotide (ODN) primers were prepared: primer A,
GACGACGACAAGATGCGTCAGATCAAGATCTGGTTCCCGAACCGTCGTATGAAGTGGAAGAAGGCAGAGATCGACCTG;
and primer B,
GAGGAGAAGCCCGGTCTAGTCTTCGGTACGCAGTACAGAGAACGGTACCTGGTCCATGATCAGGTCGATCTCTGCC.
These ODN are complementary at an overlap of 16 bases at the 3'
ends of their sequence. Mixing equimolar concentrations of the ODN in
the presence of Klenow fragment DNA polymerase (Boehringer Mannheim,
Indianapolis, IN), the two primers annealed at the respective 3' ends
and provided a suitable priming site and template for a fill-in
polymerase reaction to generate a 137-bp dsDNA fragment. This fragment
was purified and inserted into an EK/LIC 34 Novagen expression vector
(Novagen, Madison, WI). Briefly, following the manufacturers
directions, the ends of the fragment were digested by the exonuclease
function of T4 polymerase in the presence of dATP to form compatible
single-strand cohesive ends complementary to the ek/lic expression
vectors insertion site. By allowing the prepared fragment to anneal
to the supplied linearized vector and quickly transforming into
BL21competent Escherichia coli cells, the insert and vector
were ligated by the host cells replication and repair enzymes.
Transformants were grown on selective medium containing
kanamicin (Sigma, St. Louis, MO). The positively selected
tranformants were then grown overnight in Luria-Bertani broth, and
plasmid DNA was recovered by a plasmid mini prep (Qiagen, Chatsworth,
CA). Vector and insert sequences confirmed that the correct construct
had been made and was in frame. The plasmid was retransformed into BL21
cells and induced in log phase by
isopropyl-
-D-thiogalactoside to produce a
cellulose binding fusion protein with the peptide
RQIKIWFPNRRMKWKKAEIDLIMDQVPFSVLRTED. The TA peptide was cleaved
from the cellulose binding protein by digestion with enterokinase
(Novagen). The TA peptide was purified by HPLC on a C4 reverse-phase
column with an acetonitrile/0.1% trifluoroacetic acid gradient.
Purity was determined by analytical HPLC and mass spectroscopy.
Cell lines
The TAP-competent 221.A2 cell line, which was derived from a MHC class I-deficient cell line transfected with HLA-A2 (19), and the TAP-deficient T2 (20) human cell line were used as targets for the HLA-A2-restricted human CTL lines. The TAP-competent EL-4 mouse cell line (H-2b) and TAP-deficient T2 cells, transfected with the mouse H-2Kb alloantigen (T2/Kb), were used as APC for those studies using the immunodominant H-2Kb-restricted CTL epitope from OVA257 (sequence SIINFEKL). A transfected mouse L cell line expressing the H-2Kb Ag, L-Kb (provided by L. Pease, Mayo Clinic, Rochester, MN) was also used as APC to study the presentation of the OVA257 CTL epitope. All cell lines were maintained in complete RPMI medium (RPMI 1640 supplemented with 10% (v/v) FBS, L-glutamine, nonessential amino acids, sodium pyruvate, gentamicin, and selection drug marker when required). Human HLA-A2-restricted CTL lines, which recognize the IMIGVLVGV epitope from carcinoembryonic Ag (CEA) or the IMDQVPFSV melanoma CTL epitope from gp100 were generated from normal individuals using peptide-pulsed dendritic cells and were maintained in tissue culture as described elsewhere (19, 21). OVA257-specific CTL were obtained from splenocytes, which were harvested from OT-1 TCR-transgenic mice and restimulated in vitro with irradiated peptide-pulsed APC for 7 days before being used as effectors for CTL analyses. All of the culture materials were purchased from Life Technologies (Rockville, MD).
Abs and reagents
The 25D1.16 mAb, specific for the OVA257-H-2Kb complex, was produced from supernatants of hybridoma cells kindly provided by R. Germain (National Cancer Institute, National Institutes of Health, Bethesda, MD). Polyclonal Abs TGN38 (specific for a trans-Golgi marker) and anti-calreticulin (an ER marker) were kindly provided by M. McNiven (Mayo Clinic). Goat anti-mouse IgG-FITC (secondary Ab for 25D1.16), goat anti-rabbit IgG-Texas Red (secondary Ab for TGN38 and anti-calreticulin), and Prolong antifade kit were purchased from Molecular Probes (Eugene, OR). Protease inhibitors, lacatacystin, pepstatin A, and decRVKR-CMK were purchased from Bachem Bioscience (King of Prussia, PA) and were dissolved in DMSO and stored in small aliquots (100 µl) at -20°C. Brefeldin A (BFA) was purchased from Sigma (St. Louis, MO).
Cytotoxicity assays
For some experiments, the processing and presentation of peptides was determined in a standard 46-h 51Cr release cytotoxicity assay mediated by Ag-specific CTL. Peptide- or TA-pulsed targets were prepared by incubating the cells (221.A2, T2, EL-4, T2/Kb) with a predetermined concentration of Ag at 37°C overnight. The next day, the cells were washed and labeled with 300 µCi of sodium [51Cr]chromate (Amersham Pharmacia Biotech, Piscataway, NJ) for 12 h at 37°C. Various numbers of effector CTL were mixed with 2 x 104 labeled targets in 96-well round-bottom plates in a final volume of 0.2 ml of complete medium. After 46-h incubation at 37°C, 30 µl of supernatant was collected from each well and the percentage of specific lysis was determined according to the formula: [(cpm of the test sample - cpm of spontaneous release)/(cpm of the maximal release - cpm of spontaneous release)] x 100. The inhibitory effect of BFA was determined by preincubating the target cells with 1 µg/ml BFA for 1 h before peptide pulsing and during peptide incubation and then performing the cytotoxicity assay in the presence of 0.5 µg/ml BFA.
Flow cytometry
The effects of protease inhibitors on Ag processing and presentation were evaluated by analysis of 25D1.16 staining on different Ag-pulsed EL-4 or T2/Kb cells using flow cytometric analysis. In brief, EL-4 or T2/Kb cells were washed twice with serum-free AIM-V medium (Life Technologies) and pretreated with protease inhibitors (10 µM lactacycstin, 100 µM pepstatin, or 60 µM decRVKR-CMK) for 30 min, then pulsed with equimolar amounts of different peptides at 37°C overnight, with the continuous presence of the corresponding protease inhibitors. To exclude the involvement of the protease component in serum, we used serum-free AIM-V medium during the peptide-pulsing process. After washing the cells twice with FACS buffer (PBS supplemented with 2% FCS and 0.2% sodium azide), peptide-loaded APC were stained with 25D1.16 Ab followed by FITC-labeled goat anti-mouse IgG for flow analysis. Untreated EL-4 and T2/Kb cells were pulsed with peptides and stained simultaneously as controls.
Immunofluorescence and confocal microscopy
T2/Kb or L-Kb cells were cultured overnight on polylysine-treated glass coverslips. The culture medium was discarded, and the cells were gently washed once with PBS. The cells were preincubated with serum-free AIM-V medium at 37°C for 30 min and then incubated with peptide-TA solutions at the appropriate concentrations for 12 h at 37°C. After peptide loading, cells were then washed and fixed with 2% formaldehyde for 20 min at room temperature. For indirect immunofluorescence, fixed cell monolayers were permeabilized with 0.2% Triton X-100 in PBS and incubated with 5% goat serum to block nonspecific protein binding. The cells were double-labeled with mouse mAb 25D1.16 specific to the OVA257-H-2Kb complex and rabbit polyclonal Ab TGN38 (TGN marker) or rabbit anti-calreticulin (ER marker), followed by a 1-h staining with FITC-conjugated goat anti-mouse IgG and Texas Red-conjugated goat anti-rabbit IgG as secondary Abs. After washing, the coverslips were mounted on glass slides using the Prolong antifade kit (Molecular Probes). The stained cells were examined and photographed in a Leica confocal laser-scanning microscope (Leica, Deerfield, IL).
| Results |
|---|
|
|
|---|
It has been reported that peptides or proteins containing CTL
epitopes can be delivered into the cytoplasm of APC by linking these
molecules with membrane-translocating proteins such as HIVtat or
AntpHD. Once in the cytoplasm, these fusion peptides, which we call TA,
are processed via the MHC class I pathway generating MHC-peptide
complexes that are recognized by CTL. In the present study, we first
evaluated a TA composed of an HLA-A2-restricted CTL epitope for CEA
that we linked via its carboxyl-terminal end to the active portion of
the membrane-translocating region of HIVtat (RKKRRQRRR). This
construct, called CEA691-HIVtat (Table I
), was compared with the minimal CTL
epitope, CEA691, for its capacity to sensitize
HLA-A2+ target cells for lysis by a human CTL
clone that recognizes this epitope. The data shown in Fig. 1
indicate that peptides
CEA691-HIVtat and CEA691
were equally effective in sensitizing the targets for CTL lysis. In
theory, peptide CEA691 is likely to bind directly
to the surface HLA-A2 molecules that are temporarily empty or to HLA-A2
molecules by displacing low-affinity binding peptide ligands. In
contrast, we assumed that peptide CEA691-HIVtat
would not bind to surface HLA-A2 molecules but needed to enter the MHC
class I-processing pathway, which could involve some proteolysis in the
cytoplasm, followed by transport of peptides into the ER by TAP. To our
surprise, when we tested peptides CEA691-HIVtat
and CEA691 for their ability to sensitize
TAP-deficient HLA-A2+ T2 cells for CTL lysis, we
observed that both peptides had similar, if not identical, activities
(Fig. 1
B). Furthermore, Ag dose responses using the
TAP-deficient T2 cells as targets indicate that
CEA691-HIVtat and CEA691
were equally effective in generating the CTL epitope (Fig. 1
C).
|
|
The ability of peptide CEA691-HIVtat to
sensitize TAP-deficient T2 cells for CTL lysis could be explained if
this peptide was able to translocate into the ER across intracellular
membranes using the HIVtat carrier, where it would be processed into
the optimal CTL epitope. Alternatively, it is also possible that
peptide CEA691-HIVtat could be degraded
extracellularly by serum or cell-derived proteases, generating the
CEA691 minimal epitope that would then bind to
surface HLA-A2 molecules. To explore the latter possibility, we tested
the capacity of an irrelevant HLA-A2 binding peptide,
HBc1827, to block the binding of peptide
CEA691 and the possible proteolytic fragment of
CEA691-HIVtat to surface HLA-A2 molecules. As
shown in Fig. 2
A, peptide
HBc1827 was quite effective in inhibiting the
sensitization of target cells for CTL lysis by peptide
CEA691 but not the sensitization by the
CEA691-HIVtat construct. Another approach to
evaluate whether peptide CEA691-HIVtat must
penetrate into the cell to generate the CTL epitope was to treat the
peptide with trypsin, which cleaves at the carboxyl end of R or K
residues, to destroy (or decrease) the carrier function of HIVtat. The
products of trypsin digest, for example IMIGVLVGVAAAR, should lose
their membrane-translocating activity and remain susceptible to
proteolysis by an extracellular protease. The data presented in Fig. 2
B indicate that after extensive treatment with trypsin, the
CEA691-HIVtat construct lost most of its activity
with respect to sensitizing target cells for CTL lysis. As expected,
trypsin-treatment of CEA691 did not modify this
peptides sensitizing activity. To further eliminate the possibility
that peptide CEA691-HIVtat could be processed
extracellularly by a carboxypeptidase, we prepared three additional
peptides containing the CEA691 CTL epitope, which
were elongated with three positive-charged amino acids
(CEA691-KKK, CEA691-RRR,
and CEA691-RKK). In addition, we also prepared
another TA bearing the CEA691 epitope, but this
time we placed the CTL epitope at the carboxyl terminus end of the
construct. We assumed that if extracellular carboxypeptidases were
involved, this TA (HIVtat-CEA691) would not
exhibit any activity. The results shown in Fig. 2
C
demonstrate that both TA constructs,
CEA691-HIVtat and
HIVtat-CEA691, displayed similar levels of
activity in their capacity to sensitize targets for CTL lysis. In
contrast, neither CEA691-KKK,
CEA691-RRR, nor CEA691-RKK
were able to sensitize the target cells. In summary, these results
provide strong evidence that TA containing the HIVtat carrier sequence
are processed intracellularly and that CTL epitopes can be generated in
a TAP-independent manner. In addition, the data also suggest that a
highly positive charge (KKK, RRR, or RKK) at one of the peptides ends
alone is not sufficient to allow these peptides to translocate into the
cells to generate CTL epitopes and that the entire TA carrier portion
is required.
|
To extend these observations to another CTL epitope and to a
different carrier sequence, we prepared a TA construct containing the
HLA-A2-restricted melanoma CTL epitope gp100209,
which was attached to the active carrier portion of AntpHD (Table I
).
Furthermore, this construct was produced via a recombinant DNA method
instead of making a synthetic peptide (see Materials and
Methods for details). The resulting TA
(AntpHD-gp100209) also contained flanking
sequences of influenza NP to facilitate Ag processing as
suggested by Schutze-Redelmeier et al. (12). We observed
that both TAP-competent (Fig. 3
A) and TAP-deficient targets
(Fig. 3
B) were efficiently sensitized by peptide
AntpHD-gp100209 for lysis by a
gp100209-specific CTL clone. Moreover, dose-curve
responses using T2 cells as targets also indicated that construct
AntpHD-gp100209 and peptide
gp100209 had similar activities (Fig. 3
C). These results illustrate that different types of TA can
be quite effective in generating CTL epitopes in a TAP-independent
manner.
|
|
The experiments presented so far indicate that TA may have the
property of penetrating into intracellular compartments where they can
be processed to generate peptide-MHC complexes corresponding to CTL
epitopes. To assess the formation of these complexes intracellularly,
we used the TA containing the OVA257 CTL epitope
because of the availability of mAb 25D1.16, which specifically reacts
with H-2Kb-OVA257
complexes. Constructs OVA257-HIVtat and
HIVtat-OVA257 were first compared with the
OVA257 minimal epitope (SIINFEKL) for their
capacity to sensitize TAP-competent and TAP-deficient target cells for
CTL lysis. The peptide titration curves presented in Fig. 5
indicate that both of these TA were
effective, and even 10- to 1000-fold more potent than
OVA257, in sensitizing either cell type for lysis
by Ag-specific CTL.
|
|
|
So far, our results suggest that TA may be processed in various
cellular compartments to produce smaller peptides, which then associate
with MHC class I molecules that are subsequently exported to the cell
surface. Ag processing may take place: 1) in the cytoplasm, via
proteasomal degradation followed by TAP transport; 2) within the ER,
where peptide trimming via an aminopeptidase could occur; 3) in the
trans-Golgi, where processing of Ags through proteases such
as furin has been reported; and/or 4) in early endocytic compartments,
where peptides could be generated that could either bind to recycling
MHC class I molecules or leak into other compartments of the MHC class
I pathway. Using Ab 25D1.16, we studied the effects of various
inhibitors of Ag processing on the formation of
H-2Kb-OVA257 surface
complexes by peptides OVA257-HIVtat and
HIVtat-OVA257. As shown in Fig. 8
, inhibition of proteasome activity
using lactacystin (10 µM, the highest concentration used without
largely compromising the viability of the cells) did not have an effect
on the amount of surface
H-2Kb-OVA257 complexes
expressed on TAP-competent EL-4 cells (Fig. 8
, A and
B). Similarly, this proteosomal inhibitor did not have an
appreciable effect in the expression of these complexes induced by
peptide HIVtat-OVA257 on TAP-deficient cells
(Fig. 8
D). Interestingly, lactacystin appeared to increase
the level of peptide-MHC complexes resulting from the processing of the
OVA257-HIVtat construct in TAP-deficient cells
3-fold (Fig. 8
C). These results suggest that a great
proportion of the processing of these TA does not appear to take place
in the cytoplasm, even in TAP-competent cells.
|
|
It has been reported that some Ags can be processed in the
trans-Golgi by the endopeptidase action of furin, or other
similar enzymes, which cut at the C-terminal side of dibasic amino acid
recognition sequences. Thus, we tested the furin inhibitor decRVKR-CMK
(60 µM), for its ability to block the formation of peptide-MHC class
I surface complexes generated by TA. As shown in Fig. 10
, decRVKR-CMK decreased,
10-fold, the expression of surface
H-2Kb-OVA257 complexes that
were generated by OVA257-HIVtat on both
TAP-competent and TAP-deficient cells (Fig. 10
, B and
E). In contrast, no effect was observed in the formation of
the peptide-MHC complexes induced by either
HIVtat-OVA257 or OVA257 in
both cell types (Fig. 10
). These results indicate that furin (or a
similar protease) is likely to play an important role in the processing
of TA that bear the CTL epitope at the amino-terminal end, possibly by
removing a portion of the carrier, which contains several furin motifs.
Nevertheless, the smallest product of furin processing for this case,
SIINFEKLAAARK, would still require additional processing in the ER
or trans-Golgi to generate the optimal MHC binding
peptide.
|
| Discussion |
|---|
|
|
|---|
TA have been reported to deliver T cell epitopes into the interior of
APC, resulting in the formation of surface peptide-MHC class I
complexes that are recognized by CTL (12, 13). Although
the exact mechanism of how these proteins can translocate across the
plasma membrane into the cytoplasm remains a mystery, it is clear that
these molecules are internalized in a receptor- and energy-independent
fashion. We have observed that target cells can be sensitized for CTL
recognition when they are pulsed with TA for a short time in the cold
(data not shown). These findings suggest that TA do not require an
active process such as receptor-mediated endocytosis or pinocytosis to
penetrate into the cells. Notwithstanding, it has been reported that,
in some circumstances, exogenous peptides can be delivered via
pinocytosis into the ER, where they can then bind to class I MHC
molecules (23). We cannot eliminate the possibility that
under physiological conditions (at 37°C) some of the TA molecules
will be endocytosed and may end up in the ER following this pathway.
Nevertheless, our results indicate that once inside of the cell, TA can
translocate across organelle membranes into the ER and possibly into
the trans-Golgi network, gaining direct access to the
Ag-processing pathway in the secretory compartments. Our results show
that the proteasomal inhibitor, lactacystin, was not able to inhibit
the generation of surface peptide-MHC complexes by TA in TAP-competent
cells (Fig. 8
). Thus, it is possible that our TA, even though they are
relatively long (2035 residues) can be transported into the ER by TAP
without proteasomal degradation (24). However, this
possibility is difficult to imagine in our system because the TA were
highly effective in generating peptide-MHC complexes on TAP-deficient
cells. Although lactacystin did not have an effect in TAP-competent
cells, it appeared to slightly increase (
3-fold) the amounts of
peptide-MHC complexes produced by TA in TAP-deficient cells (Fig. 8
C). It is possible that lactacystin could be preventing
some degradation of the TA in the cytoplasm, increasing their
TAP-independent translocation into the secretory compartments for
subsequent Ag processing. This effect could also be due in part to the
fact that proteasome inhibitors such as lactacystin also block the
translocation of proteins from the ER to the cytosol (25).
Notwithstanding, the enhancement induced by lactacystin was not evident
in TAP-competent cells, possibly because the proteasomal degradation
products in these cells would be transported by TAP into the
ER.
Others have reported that a TA prepared by chemically conjugating HIVtat synthetic peptide to OVA protein was effective in the generation of the OVA257 CTL epitope (13). However, in contrast to our findings, this OVA protein-HIVtat construct required the function of TAP because RMA-S cells (a TAP-deficient cell line) did not generate the H-2Kb-OVA257 CTL epitope (13). It is unknown whether the OVA protein-HIVtat chemical conjugate was capable or not of translocating into the secretory pathway, but in either case it is apparent that CTL epitopes were not generated in these cell compartments. Therefore, it seems likely that the complex nature of the OVA protein-HIVtat construct required proteasomal degradation in the cytoplasm and TAP functionality to produce the CTL epitopes.
In a second report, several TA were prepared as recombinant proteins by
linking the carboxyl-terminal end of the 60-aa AntpHD protein to
another mouse CTL epitope (12). These studies concluded
that the flanking regions of the peptide epitope are critical for the
generation of the appropriate MHC binding peptides, but the role of TAP
and proteasomal degradation was not addressed. For our studies we
prepared a recombinant construct similar to the ones produced by this
group, except that we only used 15 of the 60 residues of AntpHD, which
are the ones responsible for the membrane translocation function of
this protein (16). In addition, as suggested by
Schutze-Redelmeier et al. (12), we flanked the peptide
epitope at both ends with influenza virus NP residues. Our results show
that the recombinant AntpHD-gp100209 construct,
containing the same linkers described by this group, was effective in
generating CTL epitopes (Fig. 3
). However, for all the synthetic
peptide-derived TA described here, we joined the CTL peptide sequences
at either side with the HIVtat carrier, simply by using triple-alanine
linkers (Table I
) and all of these constructs were effective in
generating the corresponding CTL epitopes. It is possible that flanking
regions of CTL epitopes may be important for proteasomal processing,
but these may not be that critical for Ag processing in the secretory
compartments, where terminal-end peptidases may play the principal
role. Because AntpHD-gp100209 was active in both
TAP-competent and TAP-deficient cells, it is evident that this
particular construct will require the activity of both amino and
carboxyl peptidases to produce the appropriate CTL epitope.
In addition to amino and carboxyl peptidases, our results show that when the CTL peptide is placed at the amino-terminal end of the TA carrier (HIVtat), the trans-Golgi-resident protease furin (or a similar endopeptidase) plays an important role in liberating the CTL epitope. Furin, which recognizes the RX(R/K)R motif (26), has been reported to participate in the TAP-independent processing of CTL epitopes in the secretory pathway. Using recombinant vaccinia virus, a CTL peptide sequence was inserted into the sequence of the secreted form of hepatitis B viral e Ag, which is targeted to the ER (18). In these experiments, the furin inhibitor decRVKR-CMK blocked the production of the corresponding CTL epitope after infection with the recombinant virus. In addition to furin, both amino and carboxyl peptidases were probably involved in the processing of this CTL epitope, because a five-alanine flanking region was placed at both ends of the epitope sequence (18). Our findings corroborate that peptide trimming can take place at both the amino- and the carboxyl-terminal ends in the secretory compartments allowing the generation of MHC binding peptides. The activity of ER-resident aminopeptidase(s) in Ag processing has been well studied by several groups (6, 7, 9, 27, 28), resulting in the "COOH-end rule," which states that the ER has a high capacity to remove NH2-terminal residues from signal sequence peptides, liberating CTL epitopes found in the COOH end (29). In contrast, little information exists regarding the existence and function of a carboxypeptidase in the secretory compartments that may participate in Ag processing. Our results and those of Gil-Torregrosa et al. (18) indicate that peptide trimming at the carboxyl-terminal end probably takes place in the trans-Golgi. It is possible that one or more of the various membrane carboxypeptidases that reside in the trans-Golgi may function in the generation of MHC binding peptides after processing by furin. We do not know whether the peptides generated in the trans-Golgi by the combined action of furin and carboxypeptidases will bind to MHC molecules in the trans-Golgi or alternatively may travel in a retrograde fashion into the ER to bind to nascent MHC molecules. We are currently exploring this possibility.
The ability to deliver CTL peptide epitopes to secretory compartments
(ER and trans-Golgi) may be advantageous for generating high
numbers of peptide-MHC class I complexes. Accordingly, peptide
sequences corresponding to CTL epitopes have been placed in the
NH2-terminal signal sequences to translocate
these products into the ER (6, 27, 30, 31). Another
approach to deliver exogenous proteins directly into the MHC class I
Ag-processing pathway has been to prepare recombinant fusion products
of bacterial toxins with CTL epitopes (32, 33, 34, 35, 36, 37, 38). However,
these constructs do not translocate across the plasma membrane but gain
intracellular access via surface receptors and travel in a retrograde
manner into the secretory compartments, where apparently they are
processed and CTL epitopes can be generated. As with TA, in some cases
the bacterial toxin constructs do not require the participation of
proteasomes or TAP to produce MHC class I binding peptides (32, 33). Although large numbers of specific peptide-MHC class I
complexes can be generated using these methods, there are potential
drawbacks for their use in vaccine development. The approach using
signal sequences requires either the use of infectious agents or gene
transduction techniques because these proteins have to be synthesized
within the cell. It is likely that this method and the use of
bacterial toxin constructs will introduce highly immunogenic and
irrelevant T cell epitopes into the APC. Lastly, it is obvious that it
is much simpler to prepare synthetic peptides of
2025 residues
than to produce recombinant viruses, plasmids, or recombinant fusion
proteins for each vaccine preparation.
In summary, we have described here a simple approach to deliver peptide constructs into APC for the generation of CTL epitopes in a TAP-independent fashion. Our results indicate that endopeptidases (furin) and NH2- and COOH-terminal peptidases participate in the processing of TA, which takes place in the secretory pathway. We believe that TA will be valuable for the development of CTL vaccines by either direct in vivo immunization or in vitro sensitization of dendritic cells to be used as cellular vaccines.
| Footnotes |
|---|
2 Address correspondence and reprint requests to Dr. Esteban Celis, Department of Immunology, GU421A, Mayo Clinic, Rochester, MN 55905. E-mail address: celis.esteban{at}mayo.edu ![]()
3 Abbreviations used in this paper: ER, endoplasmic reticulum; TA, Trojan Ag; AntpHD, Antennapedia homeodomain; NP, nucleoprotein; ODN, oligodeoxynucleotide; CEA, carcinoembryonic Ag; BFA, brefeldin A. ![]()
Received for publication February 13, 2001. Accepted for publication April 12, 2001.
| References |
|---|
|
|
|---|
This article has been cited by other articles:
![]() |
J. J. Lasarte, N. Casares, M. Gorraiz, S. Hervas-Stubbs, L. Arribillaga, C. Mansilla, M. Durantez, D. Llopiz, P. Sarobe, F. Borras-Cuesta, et al. The Extra Domain A from Fibronectin Targets Antigens to TLR4-Expressing Cells and Induces Cytotoxic T Cell Responses In Vivo J. Immunol., January 15, 2007; 178(2): 748 - 756. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. J. Wettstein, N. D. Borson, J. G. Park, K. T. McNallan, and A. M. Reed Cysteine-Tailed Class I-Binding Peptides Bind to CpG Adjuvant and Enhance Primary CTL Responses J. Immunol., September 15, 2005; 175(6): 3681 - 3689. [Abstract] [Full Text] [PDF] |
||||
![]() |
H. Zhou, Y. Luo, M. Mizutani, N. Mizutani, R. A. Reisfeld, and R. Xiang T cell-mediated suppression of angiogenesis results in tumor protective immunity Blood, September 15, 2005; 106(6): 2026 - 2032. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. T. Viehl, M. Becker-Hapak, J. S. Lewis, Y. Tanaka, U. K. Liyanage, D. C. Linehan, T. J. Eberlein, and P. S. Goedegebuure A Tat Fusion Protein-Based Tumor Vaccine for Breast Cancer Ann. Surg. Oncol., July 1, 2005; 12(7): 517 - 525. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. A. Rodeberg, R. A. Nuss, S. F. Elsawa, and E. Celis Recognition of Six-Transmembrane Epithelial Antigen of the Prostate-Expressing Tumor Cells by Peptide Antigen-Induced Cytotoxic T Lymphocytes Clin. Cancer Res., June 15, 2005; 11(12): 4545 - 4552. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. S. Block, Y. V. Mendez-Fernandez, V. P. Van Keulen, M. J. Hansen, K. S. Allen, A. L. Taboas, M. Rodriguez, and L. R. Pease Inability of bm14 Mice to Respond to Theiler's Murine Encephalomyelitis Virus Is Caused by Defective Antigen Presentation, Not Repertoire Selection J. Immunol., March 1, 2005; 174(5): 2756 - 2762. [Abstract] [Full Text] [PDF] |
||||
![]() |
I. Doytchinova, S. Hemsley, and D. R. Flower Transporter Associated with Antigen Processing Preselection of Peptides Binding to the MHC: A Bioinformatic Evaluation J. Immunol., December 1, 2004; 173(11): 6813 - 6819. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. Lu, Y. Higashimoto, E. Appella, and E. Celis Multiepitope Trojan Antigen Peptide Vaccines for the Induction of Antitumor CTL and Th Immune Responses J. Immunol., April 1, 2004; 172(7): 4575 - 4582. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. Fischer, K. Kohler, M. Fotin-Mleczek, and R. Brock A Stepwise Dissection of the Intracellular Fate of Cationic Cell-penetrating Peptides J. Biol. Chem., March 26, 2004; 279(13): 12625 - 12635. [Abstract] [Full Text] [PDF] |
||||
![]() |
Y. Tanaka, S. F. Dowdy, D. C. Linehan, T. J. Eberlein, and P. S. Goedegebuure Induction of Antigen-Specific CTL by Recombinant HIV Trans-Activating Fusion Protein-Pulsed Human Monocyte-Derived Dendritic Cells J. Immunol., February 1, 2003; 170(3): 1291 - 1298. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. C. Smith, A. Gallimore, E. Jones, B. Roberts, J. M. Lord, E. Deeks, V. Cerundolo, and L. M. Roberts Exogenous Peptides Delivered by Ricin Require Processing by Signal Peptidase for Transporter Associated with Antigen Processing-Independent MHC Class I-Restricted Presentation J. Immunol., July 1, 2002; 169(1): 99 - 107. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. Buteau, S. N. Markovic, and E. Celis Challenges in the Development of Effective Peptide Vaccines for Cancer Mayo Clin. Proc., April 1, 2002; 77(4): 339 - 349. [Abstract] [PDF] |
||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |