|
|
||||||||


*
Laboratoire dImmunologie des Pathologies infectieuses et tumorales, Institut National de la Santé et de la Recherche Médicale, Unité 445, Institut Cochin de Génétique Moléculaire, Université René Descartes, Paris, France; and
Laboratoire dImmunologie et Chimie Thérapeutiques, Centre National de la Recherche Scientifique, Unité Propre de Recherche 9021, Institut de Biologie Moléculaire et Cellulaire, Strasbourg, France
| Abstract |
|---|
|
|
|---|
| Introduction |
|---|
|
|
|---|
In MHC class I peptide presentation, the nature of the HLA alleles that select and bind peptides is important because only HLA-peptide complexes of sufficient binding affinity and stability are loaded and presented to TCRs (7, 8, 9). Degradation of Ag, binding of liberated peptides to MHC molecules, and epitope recognition by T cells must all be assessed to provide insight into the dynamic interplay that exists between Ag and T cell response, as suggested by Koup (10).
To study the antigenic potential of a protein and to identify regions
that could provide multiple T epitopes, we selected the HIV-1 Nef
protein. Its relatively small size (
200 amino acids), the knowledge
of its structure in solution (11), and the high frequency
of CTL responses directed against this protein in HIV-1-infected
individuals are the factors that governed this choice.
In the present report, we analyze the distribution of HLA-specific anchor residues, the HLA-binding capacity of relevant peptides, and the frequency of epitope presentation by each of six common HLA alleles. To examine Nef processing, we investigated the proteasome cleavage of the epitope-rich region 66100. Relationships between Nef structure, processing, and CTL epitope recognition were then sought.
| Materials and Methods |
|---|
|
|
|---|
Peptides. Synthetic peptides of 811 residues containing putative anchor-binding motifs for HLA-A2, -A3, -A24, -B7, -B8, and -B35 were selected from the Nef HIV-1/Bru sequence. They were synthesized by Chiron Mimotopes (Victoria, Australia) or Neosystem (Strasbourg, France). They were supplied by Agence Nationale de la Recherche sur le SIDA. Lyophilized peptides were dissolved in DMSO and diluted to 1 mg/ml in water (final concentration of DMSO, 10%), aliquoted, and stored at -20°C.
HLA molecules.
HLA molecules were purified from EBV-transformed B cell lines. After
cell lysis in PBS with 1% Nonidet P-40 and protease inhibitors, HLA
molecules were retained on affinity columns using anti-HLA Igs,
eluted, and then frozen at -80°C. HLA molecules were denatured in
PBS containing 12.5 mM NaOH (pH 11.7) and 1.5 M urea for 1 h at
4°C. HLA H chains and
2-microglobulin
(
2m)3
were separated from endogenous peptides on a Sephadex G25 column (PD10;
Amersham Pharmacia Biotech, Uppsala, Sweden) equilibrated in PBS
containing 0.05% Tween 20, 2 mM EDTA, and 0.1% Nonidet P-40, as
previously reported (12). Then 2 µg/ml exogenous
2m (Sigma) and 6 mM
3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate
(Sigma) were added just before addition of exogenous
peptide.
HLA-peptide binding.
Aliquots of HLA H chains (1 µg in 50 µl) were incubated with
different concentrations (10-4 and
10-6 M) of exogenous peptides in Eppendorf
microtubes (Eppendorf-Netheler-Hinz GmbH, Hamburg, Germany) for
1 h at room temperature and then for 24 h at 4°C.
Reassembled HLA molecules were further incubated for 90 min at 37°C
in wells of microtiter plates coated with anti-HLA Abs
(13). Correctly folded HLA complexes were revealed with
anti-
2m Ig coupled to alkaline
phosphatase, with 4-methyl-umbelliferyl phosphate (M-8883; Sigma, St.
Louis, MO) as substrate. Fluorescence generated was measured at 360/460
nm in a Microfluor reader (Victor 1420; Wallac, Turku, Finland).
HIV-1-seropositive donors and detection of T cells recognizing Nef peptides
Lymphocytes donors. PBMC from 76 HIV-1-seropositive individuals were isolated by density gradient centrifugation (separation medium; Flow, Irvine, U.K.) and used after freezing and thawing. Cohorts were established with the approval of the local ethics committee (Comité Consultatif de Protection des Personnes dans la Recherche Biomédicale of Cochin hospital), and all participants gave their written informed consent for the constitution of cell banks.
Enzyme-linked immunospot (ELISPOT) assay.
The IFN-
ELISPOT assay was adapted from Scheibenbogen et al. and
described by Dalod et al. (14). Ninety-six-well
nitrocellulose plates (Millipore, Bedford, MA) were coated with 2
µg/ml mouse anti-human IFN-
mAb (number 1598-00; Genzyme,
Rüsselheim, Germany). PBMCs, either freshly isolated or thawed,
were cultured overnight in complete medium (RPMI 1640 supplemented with
Glutamax, nonessential amino acids, sodium pyruvate (1 mM), HEPES
buffer (10 mM), penicillin (100 U/ml), streptomycin (100 mg/ml) (Life
Technologies, Paisley, U.K.), and 10% FCS (PAN Biotech, Aidenbach,
Germany)) and plated in triplicate at serial dilutions (3 x
105104 cells/well).
Appropriate stimuli were then added, and the plates were incubated for
20 h at 37°C in 5% CO2. After washing,
the cells were incubated with 100 µl rabbit polyclonal anti-human
IFN-
Ab diluted 1:250 (IP500; Genzyme), then with a biotinylated
anti-rabbit Ig G diluted 1:500 (Boehringer Mannheim, Mannheim,
Germany), and finally with alkaline phosphatase-labeled extravidin
(Sigma). Spots were developed by adding chromogenic alkaline
phosphatase substrate (Bio-Rad, Hercules, CA), and colored spots were
counted in a stereomicroscope. A result was considered to be
significant when the numbers of spots were at least twice the
background value (value given by negative peptides) and were
proportional to the numbers of plated cells. Frequencies of IFN-
spot-forming cells (SFC) were calculated. Positive controls for IFN
detection consisted of six wells containing 3001000 cells stimulated
with 50 ng/ml PMA and 500 ng/ml ionomycin. This strong mitogenic
stimulus verified that freezing and thawing did not introduce
artifacts, and it constituted an indirect check of overall T cell
viability. Negative controls for immune recognition consisted of
epitopes derived from various viruses (for example, peptide
Tax1119 from human T cell lymphotropic
virus-1, which associates with HLA-A2); they never elicited a
significant response compared with PBMCs incubated in medium alone.
Positive controls for immune recognition were epitopes of EBV or
influenza virus. By using purified T cell subsets, we verified that
IFN-
was secreted by CD8+ cells.
Degradation of large Nef peptide 66100
Proteasome digestion. Peptide 66100 from Nef HIV-1/Bru had the following sequence: VGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGL. It was synthesized by Neosystem. The peptide (150 µg) was incubated at 37°C with 30 µg of 20S proteasome (539150; Calbiochem, La Jolla, CA) in 200 µl assay buffer containing 20 mM Tris-HCl (pH 8) and 0.5 mM EDTA for times varying from 4 to 24 h. Cleavage products were separated by reversed phase HPLC (Perkin-Elmer, Norwalk, CT) on a C18 column (Nucleosil; 10 µm, 250 x 4.0 mm; Macherey-Nagel, Hoerdt, France) using a linear gradient of 0.1% trifluoroacetic acid in water and 0.08% trifluoroacetic acid in acetonitrile, 1% of the latter in 5 min, 110% in 5 min, 1035% in 50 min, and 3560% in 10 min at 0.8 ml/min flow rate. Chromatogram was recorded at 214 nm (759 Å; Applied Biosystems, Roissy, France). Major peaks (absorbance above 0.15 absorbance unit (AU) were collected and lyophilized.
Detection of epitopes in proteasome digests.
Thawed PBMCs of patient Z037 were cultured overnight and plated in a
96-well nitrocellulose plate at 4 x 105
cells/well in 100 µl of complete medium. Lyophilized fractions
were dissolved in complete medium, and 100 µl/well were added on
cells. ELISPOT IFN-
were revealed as described before after
overnight incubation.
Mass spectrometry analysis and Edmans sequencing.
Mass analysis was performed on a linear matrix-assisted laser
desorption ionization time-of-flight Bruker (Billerica, MA) instrument
using
-cyano-4-hydroxycinnamic acid as matrix. Peptides were
sequenced by automated Edman degradation using an Applied Biosystems
Procise CLC protein sequencer equipped with a PTH ABI 140D analyzer
(Applied Biosystems, Foster City, CA).
| Results |
|---|
|
|
|---|
Eight to eleven-mer Nef peptides with binding motifs specific for
six common HLA molecules, as defined by Sidney and Sette (15, 16), are shown in Fig. 1
.
Twenty-two of these peptides were for HLA-A2 (L, I, M, V, or A at
position 2 and V, L, or A at the C-terminal), 18 peptides for HLA-A3
with a motif requiring the presence of positively charged residues (L,
V, A, I, or T at position 2 and K, R, or Y at the C-terminal), 13
peptides for HLA-A24 (Y or F at position 2 and L, F, Y, or I at the
C-terminal), 23 peptides for HLA-B7/B35 (P or S at position 2 and a
hydrophobic residue at the C-terminal), and 5 peptides with
HLA-B8-specific motif (basic residue R or K, or Q at positions 3 and 5,
and hydrophobic residue at the C-terminal). Thus, we found 81 motifs,
and we defined 73 peptides containing one or two HLA-binding motifs
(Fig. 1
). Nef regions containing multiple motifs are, in decreasing
order: 126153 (15 motifs in 28 residues), 65112 (25 motifs in 48
residues), 180204 (13 motifs in 25 residues), and 923 (7 motifs in
15 residues). If we consider the distribution of various motifs,
HLA-A2, -A3, or -B7/35-specific motifs are observed in all regions,
whereas HLA-A24-specific motifs are mainly located in the central
region, which contains a high frequency of hydrophobic and aromatic
residues.
|
We then tested the binding of all these peptides to
the six HLA molecules. We used purified HLA H chains and synthetic
peptides as described in Materials and Methods. For each HLA
molecule, we tested a reference epitope that yielded 100% binding (see
legend of Fig. 2
). The most significant
results were obtained at a peptide concentration of
10-6 M. We defined as high binders
the peptides yielding 50100% binding and as moderate binders the
peptides yielding 2050% binding. We also considered as low binders
the peptides yielding <20% binding at 10-6 M
and >20% at 10-4 M.
|
Recognition of Nef peptides by T cells from HIV-1 infected patients
Nineteen synthetic peptides from binder-rich regions 66100 and
126146 were tested for their capacity to stimulate PBMCs from
HIV-1-infected patients ex vivo. The induction of IFN-
secretion was
revealed by ELISPOT. Only significant positive results (more than twice
the background value for each individual) were retained. An epitope may
be defined by peptide recognition by PBMCs from only one
patient. Seventeen peptides were positive. Frequencies of T cell
recognition are given in Table I
. A high
T cell recognition frequency (T cell recognition observed in at least
50% of the donors tested) was obtained with eight peptide-HLA
complexes yielding high (three of eight), moderate (three of eight), or
low (two of eight) HLA binding, respectively. Moderate T cell
recognition frequency (25 to <50%) was observed in six peptide-HLA
complexes yielding high (one of six), moderate (three of six), or low
(two of six) HLA binding. Low T cell recognition frequency was observed
in eight peptide-HLA complexes yielding high (two of eight), moderate
(five of eight), or low (one of eight) HLA binding. The frequency of T
cell recognition was not directly related to the strength of HLA
binding, which shows the influence of other factors, notably those
related to Ag processing, epitope variations, or available repertoire.
The peptides most frequently recognized were, in decreasing order,
9097, 135143, 7181, 7785, 90100, 7382, and 128137. We
determined six new epitopes: 7179 and 7181 presented by HLA-B7/B35,
8391 by HLA-A2, 126135 by HLA-A24, 130139 by HLA-B35, and
136144 by HLA-A3.
|
The large number of epitopes represented in Fig. 3
and the high frequency of T cell
recognition of some of them possibly result from an efficient
processing of the Nef regions 66100 and 126146 with liberation of
adequate peptides. As the processing of the second Nef region has
already been studied by Lucchiari-Hartz et al. (17), our
study focused on in vitro cleavage of the first region,
Nef66100. A recombinant 20S proteasome with
mainly chymotrypsin-like activity was used. Degradation was controlled
by reversed phase HPLC chromatography after various incubation times at
37°C; 24 h incubation was the optimum time (data not shown). The
major peak of the HPLC chromatogram corresponding to
Nef66100 (eluted after 67 min) greatly
decreased after 24 h incubation, whereas numerous other peaks
appeared between 30 and 55 min. Fractions corresponding to peaks
with absorbance higher than 0.15 AU were collected. A partial HPLC
chromatogram of the peptides that separated at 4070 min is
represented in Fig. 4
A. We
chose to study the generation of epitope
Nef7181 because of its central position in
Nef66100 sequence and the presence of flanking
sequences that may influence processing. As shown in Fig. 4
B, HIV-1-seropositive patient Z037 presented a very strong
response against this epitope (2800 SFC/106
PBMC). T cells of this patient were used to screen the presence of this
epitope in HPLC fractions. Peptides eluted before 40 min were not
recognized (data not shown). As shown in Fig. 4
C, fractions
C and D induced strong reactivity (>1000 SFC/106
PBMC). Analysis of peptide contents of these fractions by mass
spectrometry and Edman sequencing revealed the presence of peptide
6981 in C and 6881 in D (Table II
).
These two species are NH2-extended forms of the
Nef7181 epitope. Fraction A was not recognized
by Z037 T cells, and only Nef7281 was
characterized but was too short for inducing a stimulation. Fractions B
and E were recognized by a smaller number of effector T cells (
500
SFC/106 PBMC), and analysis of their content
revealed that major species were Nef88100
(fraction B) and Nef84100 (fraction E). T cells
from patient Z037 recognized Nef90100 with an
intensity of 570 SFC/106 PBMCs, and they probably
also recognized extended forms of this epitope
(Nef88100 and
Nef84100). However, demonstration of cleavage
by 20S proteasome at position 100 would require the use of another
COOH-terminally extended peptide. There was a relationship between the
number of T effector cells recognizing the optimal peptide
Nef7181 (2800 SFC/106
pulsed PBMCs) and the number of T cells recognizing the
NH2-extended forms
Nef6881 and Nef6981 in
fractions C and D (>1000 SFC/106 pulsed
PBMCs). Similarly, peptide Nef90100
activated 570 T effector cells, and fractions B and E, containing
NH2-extended forms of this epitope, activated
500 effectors. In summary, we have characterized the efficient
generation by 20S proteasome of different forms of
Nef7181, which is an epitope having a high
frequency of T cell recognition in HIV-infected patients.
|
|
|
| Discussion |
|---|
|
|
|---|
We chose to study further the presentation of peptides from these two
regions and their T cell recognition. A high proportion of peptides
containing HLA-A3- and HLA-B7/B35-specific motifs were good binders,
which is consistent with the high frequency of T cell recognition of
several epitopes presented by these HLA molecules. For HLA-A2, a lower
binding is also consistent with the lower frequency of Nef
epitopes identified (Table I
). Among the peptides that can bind to the
6 HLA molecules tested (Fig. 2
), 19 were tested against T cells of 76
HIV positive patients; 17 of these induced stimulation. The frequency
of T recognition was especially high for epitopes 9097 (presented by
HLA-B8), 135143 (B35), 7181 (B7 and B35), 7785 (B7), 90100
(A2), 7382 (A3), and 128137 (B7). This result suggests that few
recognition-inhibiting variations occur in these Nef segments. It may
also reveal that cellular processing liberates high quantities of these
peptides.
Although several enzymatic systems are involved in protein digestion,
proteasomes probably generate the majority of cytosolic peptides
(18). Niedermann et al. showed that processing of
polypeptides by proteasomes is conserved in evolution
(19). In APCs, IFN-
induction alters proteasomal
proteolysis in such a way that the generation of peptides with
structural features of MHC class I ligands might be optimized (4, 5). Cleavage after basic residues is possible after this IFN-
treatment, which enhances trypsin-like activity, but the majority of
changes may be quantitative rather than qualitative. In the present
report, by studying digestion of peptide
Nef66100 by a 20S proteasome having a
chymotrypsin-like activity, we identified the efficient production of
NH2-extended forms of epitope 7181. When T
cells of HIV-1-infected individuals were tested, peptide 7181 was
recognized by 75% of HLA-B7-typed donors and by 50% of HLA-B35-typed
donors (Table I
). Mass spectrometry and Edmans sequencing showed that
two NH2-extended forms,
Nef6881 and Nef6981,
were efficiently produced by 20S proteasome (Table II
). In the case of
epitope Nef7181, HLA-B7 and -B35 bindings were
low and moderate, respectively. Dominance of T cell response could be
explained by a high concentration of liberated peptides and could
therefore be very dependent on proteasome cleavage. It is interesting
to note that another epitope, Nef7481, was
recognized by 31% of HLA-B35-typed patients, and this epitope could
also have Nef6881 and
Nef6981 as precursors. However, HLA-B7-typed
patients did not recognize Nef7481 because of
its failure to bind to this HLA allele. Of the other peptides from the
same region, peptide 6876 bound very efficiently to HLA-B7, but its
frequency of T recognition was low, which could be consistent with a
very low production by proteolytic systems. In Nef region 123152,
Lucchiari-Hartz et al. (17) identified naturally processed
peptides and the generation by 20S proteasomes from T1 cells of five
epitopes from the fragment Nef123152 (128135,
128137, 135143, 136145, and 136146), presented by HLA-A2 and
HLA-B7 molecules. We tested epitopes 135143 and 128137, which were
frequently recognized by T cells of our HIV-1-infected patients. All
these data suggest that ranking of immunodominance of T cell responses
to these peptides may depend on proteasome cleavage.
By using minigenes that code for 1722-mer peptides and include one or several epitopes, different authors have shown the effect of COOH-terminal flanking residues on epitope liberation (3). According to data of Shimbara et al. (20), cleavage patterns of large peptides obtained with isolated proteasomes revealed that flanking Ala, basic, or hydrophobic residues enhance digestion, whereas flanking Gly, Pro, or acidic residues may inhibit it or prevent random cleavage and, thus, contribute to the efficient production of HLA-B7 ligands. This rule can be applied to Pro-rich Nef regions 6885 and 128143 where a large number (nine) of HLA-B7/B35-specific epitopes was detected. The abundance of hydrophobic and aromatic residues in central Nef region increases the chances of cleavage. Degradation of the 123152 region by proteasome produces several fragments that are epitopes (17), and degradation of the 66100 region probably generates numerous epitopes or their precursors.
It was then possible to define the relationships that may exist between
Nef structure and epitope liberation. The structure of HIV-1 Nef in
solution, described by Grzesiek et al. (11), comprises one
polyproline helix (residues 6978), three other helices
(residues 8194, 105118, and 194198), five
-sheet strands
(residues 100102, 126128, 134137, 142146, and 181186), and
two solvent-exposed long disordered loops (NH2
terminus 167 and 146179). An abundance of hydrophobic, aromatic,
and basic residues is compatible with high concentration of HLA-binding
motifs, structural formations such as
-sheets or helices, and
efficient proteasome digestion. In fact, regions 66100 and 126146
are both rich in HLA-binding motifs and well-structured segments of
helices (6978 and 8194), or
-sheets (126128, 134137,
142146), and their degradation by proteasomes delivers epitopes (this
study and Ref. 17). In contrast, from the Los Alamos
database (21), no CTL epitopes were identified in the
coiled loop region 2067, which is very rich in small residues (Ala,
Thr, and Ser) and in charged residues (Arg, Lys, Asp, and Glu), or in
region 146179, which is very rich in negatively charged (Asp and Glu)
residues. These two regions are poor in HLA-binding residues and are
thus unlikely to be a source of CTL epitopes.
It remains to be confirmed whether the potential of any protein to generate CTL epitopes can be predicted more precisely by analyzing both secondary and tertiary structures.
| Acknowledgments |
|---|
| Footnotes |
|---|
2 Address correspondence and reprint requests to Dr. Jeannine Choppin, Institut National de la Santé et de la Recherche Médicale, Unité 445, Institut Cochin de Génétique Moléculaire, Hôpital Cochin, 27 rue du faubourg Saint-Jacques, 75014 Paris, France. ![]()
3 Abbreviations used in this paper:
2m,
2-microglobulin; AU, absorbance unit; ELISPOT, enzyme-linked immunospot; SFC, spot-forming cells. ![]()
Received for publication July 5, 2000. Accepted for publication March 8, 2001.
| References |
|---|
|
|
|---|
This article has been cited by other articles:
![]() |
M. Schnurr, M. Orban, N. C. Robson, A. Shin, H. Braley, D. Airey, J. Cebon, E. Maraskovsky, and S. Endres ISCOMATRIX Adjuvant Induces Efficient Cross-Presentation of Tumor Antigen by Dendritic Cells via Rapid Cytosolic Antigen Delivery and Processing via Tripeptidyl Peptidase II J. Immunol., February 1, 2009; 182(3): 1253 - 1259. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. Toma, T. Laika, S. Haddouk, S. Luce, J.-P. Briand, L. Camoin, F. Connan, M. Lambert, S. Caillat-Zucman, J.-C. Carel, et al. Recognition of Human Proinsulin Leader Sequence by Class I-Restricted T-Cells in HLA-A*0201 Transgenic Mice and in Human Type 1 Diabetes Diabetes, February 1, 2009; 58(2): 394 - 402. [Abstract] [Full Text] [PDF] |
||||
![]() |
H. Barth, E. K. Schnober, C. Neumann-Haefelin, C. Thumann, M. B. Zeisel, H. M. Diepolder, Z. Hu, T. J. Liang, H. E. Blum, R. Thimme, et al. Scavenger Receptor Class B Is Required for Hepatitis C Virus Uptake and Cross-Presentation by Human Dendritic Cells J. Virol., April 1, 2008; 82(7): 3466 - 3479. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. Ueno, C. Motozono, S. Dohki, P. Mwimanzi, S. Rauch, O. T. Fackler, S. Oka, and M. Takiguchi CTL-Mediated Selective Pressure Influences Dynamic Evolution and Pathogenic Functions of HIV-1 Nef J. Immunol., January 15, 2008; 180(2): 1107 - 1116. [Abstract] [Full Text] [PDF] |
||||
![]() |
D.-W. Liu, Y.-C. Yang, H.-F. Lin, M.-F. Lin, Y.-W. Cheng, C.-C. Chu, Y.-P. Tsao, and S.-L. Chen Cytotoxic T-Lymphocyte Responses to Human Papillomavirus Type 16 E5 and E7 Proteins and HLA-A*0201-Restricted T-Cell Peptides in Cervical Cancer Patients J. Virol., March 15, 2007; 81(6): 2869 - 2879. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. Racape, F. Connan, J. Hoebeke, J. Choppin, and J.-G. Guillet Influence of dominant HIV-1 epitopes on HLA-A3/peptide complex formation PNAS, November 28, 2006; 103(48): 18208 - 18213. [Abstract] [Full Text] [PDF] |
||||
![]() |
E. J. Wherry, T. N. Golovina, S. E. Morrison, G. Sinnathamby, M. J. McElhaugh, D. C. Shockey, and L. C. Eisenlohr Re-evaluating the Generation of a "Proteasome-Independent" MHC Class I-Restricted CD8 T Cell Epitope J. Immunol., February 15, 2006; 176(4): 2249 - 2261. [Abstract] [Full Text] [PDF] |
||||
![]() |
V. Sanchez-Merino, S. Nie, and K. Luzuriaga HIV-1-Specific CD8+ T Cell Responses and Viral Evolution in Women and Infants J. Immunol., November 15, 2005; 175(10): 6976 - 6986. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. Toma, S. Haddouk, J.-P. Briand, L. Camoin, H. Gahery, F. Connan, D. Dubois-Laforgue, S. Caillat-Zucman, J.-G. Guillet, J.-C. Carel, et al. Recognition of a subregion of human proinsulin by class I-restricted T cells in type 1 diabetic patients PNAS, July 26, 2005; 102(30): 10581 - 10586. [Abstract] [Full Text] [PDF] |
||||
![]() |
M.-B. Huang, L. L. Jin, C. O. James, M. Khan, M. D. Powell, and V. C. Bond Characterization of Nef-CXCR4 Interactions Important for Apoptosis Induction J. Virol., October 15, 2004; 78(20): 11084 - 11096. [Abstract] [Full Text] [PDF] |
||||
![]() |
H. Gahery-Segard, G. Pialoux, S. Figueiredo, C. Igea, M. Surenaud, J. Gaston, H. Gras-Masse, J.-P. Levy, and J.-G. Guillet Long-Term Specific Immune Responses Induced in Humans by a Human Immunodeficiency Virus Type 1 Lipopeptide Vaccine: Characterization of CD8+-T-Cell Epitopes Recognized J. Virol., October 15, 2003; 77(20): 11220 - 11231. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Lucchiari-Hartz, V. Lindo, N. Hitziger, S. Gaedicke, L. Saveanu, P. M. van Endert, F. Greer, K. Eichmann, and G. Niedermann Differential proteasomal processing of hydrophobic and hydrophilic protein regions: Contribution to cytotoxic T lymphocyte epitope clustering in HIV-1-Nef PNAS, June 24, 2003; 100(13): 7755 - 7760. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. Ogata, A. Jaramillo, W. Cohen, J.-P. Briand, F. Connan, J. Choppin, S. Muller, and S. J. Wodak Automatic Sequence Design of Major Histocompatibility Complex Class I Binding Peptides Impairing CD8+ T Cell Recognition J. Biol. Chem., January 3, 2003; 278(2): 1281 - 1290. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Andrieu, J.-F. Desoutter, E. Loing, J. Gaston, D. Hanau, J.-G. Guillet, and A. Hosmalin Two Human Immunodeficiency Virus Vaccinal Lipopeptides Follow Different Cross-Presentation Pathways in Human Dendritic Cells J. Virol., December 20, 2002; 77(2): 1564 - 1570. [Abstract] [Full Text] [PDF] |
||||
![]() |
W. M. Cohen, A. Bianco, F. Connan, L. Camoin, M. Dalod, G. Lauvau, E. Ferries, B. Culmann-Penciolelli, P. M. van Endert, J. P. Briand, et al. Study of Antigen-Processing Steps Reveals Preferences Explaining Differential Biological Outcomes of Two HLA-A2-Restricted Immunodominant Epitopes from Human Immunodeficiency Virus Type 1 J. Virol., September 11, 2002; 76(20): 10219 - 10225. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |