|
|
||||||||




*
Department of Pathophysiology,
Division of Hematology, Department of Internal Medicine I, University of Vienna, Austria;
Structural Biology Programme, European Molecular Biology Laboratory, Heidelberg, Germany;
§
Research Center Borstel, Germany;
¶
Department of Molecular Cell Biology, Institute of Biology, University of Oslo, Norway;
||
Institute of Immunology, University of Vienna, Vienna, Austria; and
#
Department of Allergy and Clinical Immunology, Monash Medical School, Prahran, Australia
| Abstract |
|---|
|
|
|---|
helical secondary structure, and exhibited a remarkable refolding
capacity. It reacted with serum IgE from 76% of grass pollen-allergic
patients and revealed an extremely high allergenic activity in basophil
histamine release as well as skin test experiments. Thus, the rPhl p 5A
domain represents an important allergen domain containing several IgE
epitopes in a configuration optimal for efficient effector cell
activation. We suggest the rPhl p 5A fragment and the corresponding IgE
Fab as paradigmatic tools to explore the structural requirements for
highly efficient effector cell activation and, perhaps later, for the
development of generally applicable allergen-specific therapy
strategies. | Introduction |
|---|
|
|
|---|
With the implementation of molecular biological techniques to the field of allergen characterization, the sequence, nature, and three-dimensional structure of several important allergens have been revealed, and we begin to understand how IgE Abs recognize allergens at a molecular level (4, 5, 6). As for B cell epitopes in general, basically two types of IgE epitopes have been identified. Epitopes that consist of a stretch of few contiguous amino acids are termed "continuous epitopes" (7). Epitopes composed of at least two nonadjacent domains of the molecule that are brought into close proximity within the folded molecule are named "discontinuous epitopes" (7). IgE epitopes of several relevant allergens, e.g., the major birch pollen allergen Bet v 1 (8), the calcium-binding pollen allergens, Bet v 3 (9), Bet v 4 (10, 11), Phl p 7 (12), Aln g 4 (13), Bra r 1 (14), and parvalbumin (15), belong to the discontinuous type. Continuous IgE epitopes were identified on several grass pollen allergens, e.g., major rye grass pollen allergens Lol p 1 (16) and Lol p 5 (17), major timothy grass pollen allergen Phl p 1 (18, 19), and velvet grass allergen Hol l 1 (20).
Investigations on the three-dimensional structure and IgE epitopes of major allergens have recently gained great attention as they may open new avenues to reduce the allergenic activity of allergens by genetic engineering or peptide chemistry (5, 21). Although there seems to be no common structural theme that would determine the allergenic activity of a given protein, it turned out that proper folding and high propensity to refold after denaturation are frequent features of potent allergens (12, 13, 15, 22, 23, 24, 25).
To obtain monoclonal IgE Abs with specificity for major allergens we have constructed an IgE combinatorial library from lymphocytes of a grass pollen-allergic patient (26). Here we study the interaction of a recombinant monoclonal human IgE Fab with one of the most prominent and potent environmental allergens, the major timothy grass pollen allergen Phl p 5A (27). Phl p 5A represents a major grass pollen allergen that is recognized by >80% of grass pollen-allergic patients. In sensitized patients it accounts for up to 60% of grass pollen-specific IgE, it induces strong IgE responses in experimental animal systems, and exhibits a surprising potency to activate allergic effector cells and to elicit immediate type skin and nasal reactions (27, 28, 29, 30 ; V. Niederberger and R. Valenta, unpublished data). By allergen gene fragmentation we identified a Phl p 5A domain that contains the binding site for the human monoclonal IgE Fab. The IgE Fab-defined Phl p 5A fragment was expressed in Escherichia coli, purified to homogeneity, and characterized regarding its secondary structure contents, thermal stability, and refolding capacity by circular dichroism (CD)3 analysis. IgE binding, basophil histamine release, and skin prick testing revealed that the fragment represents an important allergen domain for most grass pollen-allergic patients and exhibits high allergenic activity. We suggest the three-dimensional structure analysis of the interaction of the rPhl p 5A domain and its corresponding IgE Ab for the elucidation of the structural requirements for highly efficient effector cell activation.
| Materials and Methods |
|---|
|
|
|---|
Pollen from timothy grass, sweet vernal grass, oat, Bermuda grass, rye grass, common reed, Kentucky Bluegrass, rye, wheat, and maize were purchased from Allergon (Välinge, Sweden). Sera were collected from grass pollen-allergic patients who were characterized by case history, skin prick testing, 125I-labeled anti-human IgE Abs (RAST), and by testing with recombinant grass pollen allergens as described (31, 32). Sera from allergic patients without grass pollen allergy and from nonallergic individuals were included as negative controls. A rabbit anti-rPhl p 5A antiserum was obtained by immunization of a rabbit with purified rPhl p 5A using CFA (Charles River, Kissleg, Germany). A 125I-labeled donkey anti-rabbit Ig antiserum was purchased from Amersham (Buckinghamshire, U.K.). Mouse mAbs BG6 and Bo9 with specificity for Phl p 5A and Phl p 5B, respectively, are described (33). An alkaline phosphatase (AP)-coupled rabbit anti-mouse IgG+IgM antiserum was purchased from Jackson ImmunoResearch (West Grove, Pa.). RAST were obtained from Pharmacia (Pharmacia Diagnostics, Uppsala, Sweden).
Preparation of pollen extracts, recombinant allergens, and allergen fragments
One hundred milligrams of natural pollen of each grass and corn
species were separately resuspended in 5 ml SDS-sample buffer and
homogenized with an ultraturrax (IKA, Stauffen, Germany) for 1 min,
boiled for 5 min at 95°C, and centrifuged at 14,500 rpm in a bench
fuge for 5 min to remove insoluble materials (34). Comparable amounts
of extracted proteins (
100 µg/cm) were separated by a preparative
14% SDS-PAGE under reducing conditions and blotted onto nitrocellulose
(35, 36, 37). Recombinant Phl p 5A and rPhl p 6 were expressed
in E. coli BL21 (DE3) and purified as described (25, 28). Recombinant Phl p 5B and a recombinant fragment comprising
the 136 C-terminal amino acids of Phl p 5B were expressed in E.
coli using plasmid pMalc and purified as described
(38).
Expression of a recombinant human IgE Fab and a complete Fab-derived recombinant human IgG1 with specificity for Phl p 5A
A human IgE Fab (clone 5) with specificity for the major timothy grass pollen allergen, Phl p 5A, was obtained from an IgE combinatorial library constructed from lymphocytes of a grass pollen-allergic patient (26). cDNAs coding for IgE Fds and light chains were obtained by RT-PCR from lymphocyte-derived RNA and recombined in plasmid pComb3H. The phage expressing a human Phl p 5A-specific IgE Fab was isolated via panning to ELISA plate-bound Phl p 5A. Soluble Phl p 5A-specific recombinant IgE Fabs were produced by removing the SpeI and NheI fragment from the original pComb3H construct. The resulting plasmid construct was transformed into E. coli XL-1 Blue and expressed in liquid culture (LB medium containing 50 mg/L ampicillin) after addition of isopropyl-ß-thiogalactopyranoside (IPTG) to a final concentration of 1.5 mM as described (39). For control purposes, E. coli cultures were transformed with a construct expressing an IgE Fab with specificity for a Phl p 5A-unrelated allergen. Fab containing E. coli extracts were prepared as described (39).
Complete recombinant IgG1 Abs containing the Fab-derived variable
regions were obtained by expression in mammalian cells. cDNAs coding
for the heavy and light chain variable region of the IgE Fab were
amplified from the IgE Fab-expressing pComb3H plasmid using the VH
(5'VH primer: CGG GAT CCG TGC ATT CCG AGG TGC AGC TGC TCG
AG; 3'VH primer: CGG GAT CCG ACG TAC GAC TCA CCT GAA GAG ACG
GTG ACC AT) and VK (5'VK primer: CGG AAT TCG TGC ATT CCG
ACA TCC AGA TGA CCC AGT CTC CAT CTT CC; 3'VK primer: CGG AAT TCA
CGT ACG TTC TAC TCA CGT TTG ATT TCC ACC TT) primer pairs,
respectively. These primer pairs contained BsmI (underlined) and BsiWI
(italics) restriction sites to allow subcloning of the VH products into
plasmid pLNOH2 and of the VK product into plasmid pLNOK
(40). The correct insertions of the Fab-derived cDNAs
coding for heavy chain and light chain variable regions into the
plasmids were confirmed by sequencing of the constructs. Plasmids
pLNOH2 and pLNOK allowed transient coexpression of the Fab-derived
variable regions as IgG1 heavy chain and
light chain, respectively,
after cotransfection into COS-7 cells (40). Supernatants
of transfected COS-7 cells were checked for the presence of human IgG1
Abs with specificity for the recombinant Phl p 5A fragment by ELISA as
described (28).
The concentrations of Phl p 5A fragment-reactive IgE Fabs and the complete IgG1 were determined by ELISA in duplicate determinations. Recombinant ELISA plate-bound Phl p 5A fragment was exposed to serial 1:2 dilutions of E. coli extracts containing the IgE Fab to culture supernatants with the complete IgG1 Ab and, to establish reference curves, to different concentrations of purified reagents purified via affinity to the allergen (26). Bound Fabs and IgG1 Abs were detected with an AP-conjugated goat anti-human Fab antiserum (Pierce, Rockford, IL). The concentrations of Fab and IgG1 in the extracts were calculated according to the reference curves established with the affinity-purified materials.
Mapping of the binding site of the human IgE Fab using recombinant allergen fragments
A random fragment expression library prepared from sonicated Lol
p 5A and Lol p 5B cDNAs in phage
gt11 was screened with serum IgE
from grass pollen-allergic patients to identify IgE-reactive allergen
fragments (17).
gt11 clones expressing IgE-reactive
fragments of the major rye grass pollen allergens Lol p 5A and Lol p
5B, and for control purposes, phage containing unrelated cDNAs (clones
29, 31, and 87) or empty wild-type phage (clone 0) were probed for
reactivity with the recombinant human IgE Fab. In brief, E.
coli Y1090 were grown overnight in LB medium containing 0.4% w/v
maltose and 50 µg/ml ampicillin, harvested by centrifugation (3000
rpm, 10 min, 4°C), and resuspended in 1:10 vol of 10 mM
MgSO4. E. coli were then dissolved in
0.6% w/v agarose and plated as confluent lawn onto LB plates
containing 50 mg/L ampicillin. One-microliter aliquots of phage lysates
containing >105 PFUs were dotted onto the
plates. Plates were incubated at 43°C until plaques became visible
and protein synthesis was induced by overlay with 10 mM IPTG-soaked
nitrocellulose filters for an additional 34 h at 37°C. The phage
clone that reacted with the IgE Fab was identified by immunoscreening,
and the corresponding phage DNA was isolated (41). The
cDNA encoding the Fab-reactive Lol p 5B fragment was PCR amplified from
phage DNA using
gt forward: 5'-CGG GAT CCC GGT TTC CAT
ATG GGG ATT GGT GGC-3' and
gt11 reverse: 5'-CGC GGA TCC
CGT TGA CAC CAG ACC AAC TGG TAA TG-3' primers containing internal
BamHI sites (underlined). The PCR product was cut with
BamHI, gel-purified, subcloned into plasmid pUC18, and
sequenced (41, 42).
Multiple sequence alignment and secondary structure prediction of Phl p 5A- homologous allergens
Search between the deduced amino acid sequence of the rLol p 5B fragment and protein databases was made using the FASTA program of the GCG package (43). Multiple sequence alignment was produced with CLUSTAL W (44) and, if necessary, edited by hand. Protein secondary structure and solvent accessibility predictions were made using the PHD program on the EMBL PredictProtein server (45, 46).
Two-dimensional PAGE and immunoblotting
Two-dimensional PAGE was performed according to Görg et al. (47). The proteins were immediately blotted onto nitrocellulose membranes. The determination of pI and m.w. was achieved by the use of a marker protein test mix 9 (Serva, Heidelberg, Germany) and low range SDS-PAGE standards (Bio-Rad, Richmond, CA), respectively. Nitrocellulose sheets containing timothy grass pollen extract separated by two-dimensional electrophoresis were blocked twice for 5 min and once for 30 min with TBST (50 mM Tris, 150 mM NaCl, pH 7.5, containing 0.1% v/v Tween 20) containing 0.5% w/v BSA at room temperature. The membranes were then probed with serum IgE (diluted 1:10 in TBST/0.5% w/v BSA) from the grass pollen-allergic patient used for the construction of the IgE combinatorial library (26), with the recombinant human IgE Fab (bacterial periplasmic extract diluted 1:1 in TBST/0.5% w/v BSA) and with culture supernatants from hybridomas secreting mouse mAbs with specificity for Phl p 5A (BG6) or Phl p 5B (Bo9) diluted 1:10 in TBST/0.5% w/v BSA overnight at 4°C. Membranes were washed two times for 15 min and once for 30 min with TBST/0.5% w/v BSA. Bound human IgE Abs were detected with RAST (Pharmacia) diluted 1:10 in buffer A (50 mM sodium phosphate buffer, pH 7.4, containing 0.5% w/v BSA, 0.5% v/v Tween 20, and 0.05% w/v NaN3) overnight. Bound IgE Fabs were visualized with an AP-coupled goat anti-human Fab antiserum (Pierce) diluted 1:5000 in TBST/0.5% w/v BSA, and bound mouse Abs were detected with an AP-conjugated rabbit anti-mouse Ig antiserum (The Jackson Laboratory, Bar Harbor, ME) diluted 1:2000 in TBST/0.5% w/v BSA.
Reactivity of serum IgE and the recombinant monoclonal human IgE Fab with rPhl p 5 isoforms/fragments
Nitrocellulose membranes containing comparable amounts (5 µg/cm preparative SDS-PAGE) of blotted recombinant allergens (rPhl p 5A, rPhl p 5B, the N-terminal Phl p 5A fragment, and a C-terminal Phl p 5B fragment) were blocked in buffer A and incubated with 1:5 in buffer A-diluted sera from grass pollen-allergic patients, and for control purposes, with serum from an allergic patient without grass pollen allergy and serum from a nonatopic individual overnight at 4°C. In addition, blots were incubated with bacterial extracts with and without the recombinant IgE Fab. After washing, bound human IgE Abs were detected with 125I-labeled anti-human IgE Abs (Pharmacia) and bound IgE Fabs with an AP-coupled goat anti-human Fab antiserum (Pierce).
Expression and purification of the rPhl p 5A allergen fragment
A recombinant rPhl p 5A fragment equivalent to the Fab-reactive
Lol p 5B fragment (Fig. 1
C)
was obtained by inserting the cDNA coding for amino acid 56-165 of Phl
p 5A into plasmid pET17b and expressing the allergen domain in E.
coli BL 21(DE3). Transformed bacteria were grown in liquid culture
to an OD600 nm of 0.6-0.8, and protein synthesis
was induced by the addition of IPTG to a final concentration of 0.5 mM.
Cells were harvested by centrifugation, suspended in 25 mM imidazole,
pH 7.4, 0.1% Triton X-100, lysed for 30 min at room temperature by the
addition of lysozyme (20 µg/g cells), and by three to four cycles of
freeze-thawing. DNA in the bacterial extract was digested by the
addition of DNase I (0.1 mg/g cells) and incubation for 20 min at room
temperature. The extract was then centrifuged for 20 min at 18,000 rpm
to remove insoluble materials. Addition of ammonium sulfate (4060%
w/v) to the supernatant enriched the rPhl p 5A fragment in the protein
precipitate. The pellet was resuspended in 5 ml 10 mM sodium phosphate
buffer, pH 7, and desalted via Sephadex PD 10 columns (Pharmacia). The
eluate was applied to a Sp-Sepharose column (Pharmacia) in 10 mM sodium
phosphate buffer, pH 7, and eluted with a 00.5 M NaCl gradient.
Fractions containing >80% pure rPhl p 5A fragment were dialysed
against 10 mM Tris, pH 10, and loaded onto a DEAE cellulose-Sepharose
column (Pharmacia). rPhl p 5A fragment was purified to homogeneity by
elution with a 00.5 M NaCl gradient. Fractions containing a
homogenous rPhl p 5A fragment preparation were lyophilized, resuspended
in Aqua bidest. and desalted using Sephadex PD 10 columns. The protein
concentration was determined using the protein extinction coefficient
according to (48). Mass spectroscopic analysis was
performed on a triple quadrupole mass spectrometer (API III; PE-SCIEX,
Ontario, Canada).
|
CD spectra were recorded on a Jasco J-710 spectropolarimeter
fitted with a thermostatted cell holder and interfaced with a Neslab
RTE-110 water bath. The instrument was calibrated with a 0.1% aqueous
solution of d-10-camphor-sulfonic acid. Results were expressed as mean
residue ellipticity (
) (x 10-3 deg x
cm2 x dmol-1), at a given
wavelength. Far-UV CD spectra were recorded in quartz cuvettes (Hellma;
Mullheim, Baden, Germany). Spectra were recorded with 0.1-nm resolution
and resulted from averaging 10 scans. Final spectra were corrected by
subtracting the corresponding baseline spectrum obtained under
identical conditions. All measurements were performed in MilliQ water,
pH 7.2.
Thermal stability followed by CD
Thermal denaturation of the rPhl p 5A fragment was monitored by
recording the ellipticity at 222 nm while heating at 50°C/h with a
computer-controlled circulating water bath. The reversibility of the
unfolding process was checked by measuring the restoration of the CD
signal upon cooling at 50°C/h to the starting temperature (20°C).
The fraction of folded protein was calculated as F =
1 - U, where U =
(
222 -
N)/(
U -
N),
N is the
ellipticity of the protein in the native state, and
U is that of the denatured protein. For rPhl p
5A fragment,
U was assumed equal to
222 at 90°C and
222
at 20°C.
IgE binding experiments
Serum IgE with specificity for complete rPhl p 5A and the rPhl p
5A fragment was quantified by RAST-based experiments. To ensure Ag
excess, 8-µg aliquots of each protein were immobilized to
nitrocellulose under nondenaturing conditions by dot blotting.
Nitrocellulose-bound proteins were exposed in duplicate to two
different serum dilutions (1:4, 1:8) prepared in buffer A as described
for two-dimensional blots. Bound IgE Abs were detected with RAST
(Pharmacia) and quantified by gamma counting in a gamma counter (1277
Gammamaster; LKB, Wallac, Gaithersburg, MD). Results represent means of
duplicate determinations with variations of <10%, and the percentage
of Phl p 5A-specific IgE bound by the rPhl p 5A fragment is displayed
(Table I
).
|
The influence of the human IgE Fab, a corresponding bivalent
IgG1 Ab, and a polyclonal rabbit anti-rPhl p 5A antiserum on the
binding of patients IgE Abs to the rPhl p 5A fragment was investigated
by ELISA competition experiments. Purified rPhl p 5A fragment was
coated to ELISA plates (Greiner, Kremsmünster, Austria) in 0.1 M
sodium bicarbonate pH 9.6 (1 µg/ml) overnight at 4°C. Plates were
washed twice with TBST containing 0.5% w/v BSA and blocked with TBST
containing 3% w/v BSA at 37°C for 3 h. ELISA plate-bound rPhl p
5A fragment was preincubated overnight at 4°C with in TBST-diluted
bacterial lysate containing 1.5 µg/ml of the recombinant human Phl p
5-specific IgE Fab or, for control purposes, with bacterial lysates
containing a recombinant IgE Fab specific for a Phl p 5A-unrelated
allergen. In similar experiments, ELISA plate-bound rPhl p 5A fragment
was preincubated with culture medium without (control) or with 1.5
µg/ml of a recombinant bivalent Phl p 5A-specific IgG1, a rabbit
anti-rPhl p 5A antiserum or, for control purposes, with the
preimmune serum of the rabbit, diluted 1:100 in TBST. After
preincubations, plates were washed five times in TBST containing 0.5%
w/v BSA and 100-µl aliquots of patients sera (diluted 1:5 in TBST
containing 0.5% w/v BSA) were added to the wells overnight at 4°C.
Plates were then washed five times with TBST/0.5% w/v BSA and
incubated with an AP-coupled mouse anti-human IgE mAb (PharMingen,
San Diego, CA) diluted 1:1000 in TBST/0.5% w/v BSA at 37°C for
2 h. Plates were washed five times and bound anti-human IgE
Abs were visualized by color reaction using AP substrate (Sigma, St.
Louis, MO). Optical densities corresponding to the amounts of bound IgE
Abs were measured in an ELISA reader at a 405-nm wavelength (Dynatech,
Denkendorf, Germany). To avoid plate-to-plate variabilities,
experiments were performed for the serum of each in duplicate on the
same plate, and results were recorded at the same time point. The
percentage of inhibition of IgE binding was calculated from the mean OD
values measured with or without addition of competitor according to the
following formula: % inhibition = 100 -
ODinhibitor x
100/ODcontrol (Table II
).
|
Heparinized blood samples were obtained by venipuncture from six grass pollen-allergic patients and, for control purposes, from a nonatopic individual after informed consent was given. Granulocytes were isolated by dextran sedimentation and histamine release experiments were performed as described (49). In brief, enriched basophils were exposed to different concentrations of purified rPhl p 5A, the recombinant Phl p 5A fragment, rPhl p 6, or a monoclonal anti-human IgE Ab for 30 min at 37°C. Then, cells were centrifuged at 4°C and the cell-free supernatants were recovered. Histamine released in the cell-free supernatants was determined by RIA (Immunotech, Marseille, France) and is expressed as the percentage of total histamine determined after cell lysis (49).
Skin prick testing
After informed consent was obtained from three grass
pollen-allergic patients and one nonallergic individual, skin prick
tests were performed on the forearms of the patients as described
(8). Individuals were pricked with 20-µl aliquots of
solutions containing different concentrations (125, 25, 5,1, and 0.2
µg/ml) of purified rPhl p 5A fragment and rPhl p 5A diluted in 0.9%
sodium chloride. For control purposes, histamine, NaCl, timothy grass,
and birch pollen extract (ALK, Horsholm, Denmark) were used. The skin
reactions were recorded 20 min after testing by photography and by
transferring the ballpoint pen-surrounded wheal area with a scotch tape
to paper. The mean wheal diameters displayed in Table III
were determined as follows:
DM = (D1 + D2)/2. D1
and D2 represent the maximal longitudinal and transversal
diameters, respectively, in millimeters.
|
| Results |
|---|
|
|
|---|
IgE-reactive phages were isolated from an available cDNA library
expressing recombinant Lol p 5 fragments as described
(17). These phage clones (Fig. 1
A, clones
11123) and for control purposes, phage clones containing cDNAs
unrelated to Lol p 5 (Fig. 1
B, clones 29, 31, and 87) or
wild-type phage (clone 0), were tested for reactivity with the
recombinant human IgE Fab (Fig. 1
, A and B). One
of the Lol p 5-derived fragment clones (Fig. 1
B, clone 81)
reacted with the IgE Fab. Clone 81 represented an N-terminal fragment
comprising amino acid 36-141 of the mature Lol p 5B (Fig. 1
C, top line). Notably, two other Lol p 5B-derived clones
(clone 120:
FGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPAND,
aa 77-189; clone 123:
SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVE GLASGYADQS, aa
36-97), which together covered the entire sequence defined by
clone 81, did not react with the IgE Fab. This finding would indicate
that the Fab recognizes a conformational epitope that requires most of
the clone 81-defined sequence. The clone 81-defined Lol p 5B fragment
corresponded to an N-terminal fragment of Phl p 5 (timothy
grass-Phleum pratense), which is highly homologous to group
5 allergens from velvet grass (Holcus lanatus), Kentucky
Bluegrass (Poa pratensis), Canary grass (Phaseolus
aquaticus), wheat (Hordeum vulgare), and group 6
allergens from timothy grass. The secondary structure prediction of the
clone 81-defined Lol p 5B fragment indicated that it consists almost
exclusively of an
helical secondary structure, which is composed by
four
-helices (data not shown). Within the clone 81-defined
fragment, Phl p 5A, Lol p 5B, and Poa p 5 isoforms exhibited the
highest degree of sequence homology, whereas Phl p 5B, Lol p 5A, and
Phl p 6 lacked several amino acids (Fig. 1
C). Therefore, we
used the clone 81-defined Lol p 5B sequence to produce the
corresponding domain of the timothy grass pollen allergen Phl p 5A as
recombinant protein (Fig. 1
C, second line).
The recombinant human IgE Fab reacts with an N-terminal fragment of Phl p 5A
The cDNA coding for the Phl p 5A fragment corresponding to the
clone 81-defined Lol p 5B fragment (Fig. 1
C, second line)
was PCR-amplified from the Phl p 5A-encoding cDNA (27) and
inserted into plasmid pET17b. The N-terminal rPhl p 5A fragment was
produced in the cytoplasm of E. coli as soluble protein and
could be purified to homogeneity. In SDS-PAGE purified rPhl p 5A
fragment migrated at 11 kDa, and the matrix-assisted laser desorption
and ionization time-of-flight analysis of the purified rPhl p 5A
fragment revealed the presence of a major peak at 11.2 kDa (data not
shown).
Next we tested sera from grass pollen-allergic individuals and the
recombinant IgE Fab for reactivity to nitrocellulose-blotted rPhl p 5A,
rPhl p 5B, the N-terminal rPhl p 5A fragment comprising the clone
81-defined portion (Fig. 1
C), and a 136-aa-long C-terminal
recombinant fragment of rPhl p 5B. Sera from all seven grass
pollen-allergic patients displayed IgE reactivity to rPhl p 5A and B
(Fig. 2
, A and B,
lanes 17) as well as to the recombinant allergen
fragments (Fig. 2
, C and D, lanes
17). The recombinant human IgE Fab reacted with complete rPhl p
5A and the N-terminal recombinant rPhl p 5A fragment, but did not bind
to rPhl p 5B or the C-terminal rPhl p 5B fragment (Fig. 2
, AD, lane
Phl p
5). Bacterial extracts without the recombinant human IgE Fab did
not react with blotted rPhl p 5 isoforms nor with their fragments (Fig. 2
, AD, lane C). Sera from a birch
pollen-allergic patient without grass pollen allergy (lane
A) and a nonatopic individual (lane N) contained
no IgE Abs to any of the blotted proteins (Fig. 2
, AD). Our finding, that the recombinant human
IgE Fab reacts specifically with an epitope on the N-terminal fragment
of rPhl p 5A, is confirmed by experiments performed with
two-dimensional separated natural timothy grass pollen extract (Fig. 3
, AD). Serum IgE
from a grass pollen-allergic patient reacted with natural Phl p 5A (38
kDa) and Phl p 5B (32 kDa) pI variants (Fig. 3
A). The
recombinant human IgE Fab (Fig. 3
B) as well as a Phl p
5A-specific mouse moAb BG6 (Fig. 3
C) reacted exclusively
with the natural Phl p 5A pI variants at 38 kDa. The pI variants at 32
kDa were identified as being Phl p 5B-derived by a Phl p 5B-specific
mouse moAb Bo9 (Fig. 3
D).
|
|
To investigate whether the recombinant human IgE Fab cross-reacts
with natural group 5 allergens from different grass and corn species,
nitrocellulose-blotted natural pollen extracts from several grass and
corn species were tested (Fig. 4
). The
IgE Fab reacted strongly with group 5 allergens in timothy grass,
Kentucky Bluegrass, rye grass, and rye, and exhibited weaker reactivity
to 30-kDa moities in common reed and wheat (Fig. 4
). No reactivity was
observed with pollen extracts from monocots reportedly lacking or
containing low levels of group 5 allergens (sweet vernal grass, oat,
Bermuda grass, and maize) (32). Thus the recombinant human
IgE Fab detected a cross-reactive epitope in group 5 allergens from
various grass and corn species.
|
The far UV CD spectrum of rPhl p 5A taken at 20°C (Fig. 5
A) is characterized by two
broad minima at 207 and 221 nm. Similarly, rPhl p 5A fragment shows two
broad minima at 208 and 222 nm and a maximum at 191 nm (Fig. 5
B). The far UV CD spectra of rPhl p 5A, the rPhl p 5A
fragment, and rPhl p 6 recorded at 20°C, indicate a common
helical protein fold (Fig. 5
D). This finding is in agreement
with the PHD secondary structure prediction performed on the multiple
sequence alignment of group 5 allergens and Phl p 6 (data not
shown).
|
62°C (Fig. 5The IgE Fab-defined rPhl p 5A fragment represents a frequently recognized allergen domain containing several IgE epitopes
When we analyzed sera from 58 grass pollen-allergic individuals
and from three nonatopic persons for the presence of rPh p 5A and rPhl
p 5A fragment-specific IgE, we found that 44 sera (76%) displayed IgE
reactivity with rPhl p 5A and the rPhl p 5A fragment (data not shown).
The IgE binding capacity of complete rPhl p 5A and the rPhl p 5A
fragment was analyzed in detail for 26 Phl p 5A-reactive sera in a
quantitative RAST-based assay using two different serum dilutions (1:4
and 1:8). Using the 1:8 serum dilutions, we found that the rPhl p 5A
fragment bound between 7.8 and 51.1% (mean: 24.0%) of the Phl p
5A-specific IgE (Table I
). Similar results were obtained for the 1:4
serum dilutions, indicating that 542.1% (mean: 20.6%) of Phl p
5A-specific IgE was directed against the fragment (data not shown).
The percentage of rPhl p 5A-specific Abs bound by the rPhl p 5A domain
corresponded to its size but suggested that it contains binding sites
for IgE Abs with other specificities in addition to the Fab-defined
epitope. This assumption was supported by competition experiments. The
IgE Fab and a complete bivalent IgG1 Ab generated by expressing the
variable region of the Fab fused to a human IgG1 constant region were
used in >1000-fold excess to serum IgE (1.5 µg/ml). Preincubation of
the rPhl p 5A fragment with the IgE Fab and the complete recombinant
bivalent IgG1 derived from the Fab inhibited IgE binding of eight sera
to a low degree (Fab: 3.720.6% inhibition; mean, 11.1%; IgG1:
0.436.8%; mean: 22.9%) (Table II
). By contrast we found that
polyclonal anti-Phl p 5A IgG Abs profoundly (73.988.7%; mean,
83.2%) inhibited IgE binding of the same eight sera to the rPhl p 5
fragment (Table II
).
Complete rPhl p 5A and the recombinant Phl p 5A fragment strongly induce histamine release from basophils of sensitized patients
Exposure of basophils from four grass pollen-allergic
patients to purified rPhl p 5A and the rPhl p 5A fragment resulted in
maximal histamine release already at very low allergen concentrations
(10-4 µg/ml). Therefore, both proteins were
further diluted and exposed to basophils of a patient containing IgE
Abs against complete rPhl p 5A and the rPhl p 5A fragment, but not to
rPhl p 6 (Fig. 6
A). In this
patient, the rPhl p 5A fragment and rPhl p 5A started to induce
histamine release at concentrations between
10-16 and 10-14 µg/ml
and between 10-14 and
10-12 µg/ml, respectively (Fig. 6
A). The fact that the rPhl p 5A fragment more potently
induced histamine than complete rPhl p 5A was of note because
quantitative IgE binding tests showed that in this patient only 19.5%
of Phl p 5A-specific IgE were directed against the Phl p 5A fragment.
rPhl p 6, a structurally related allergen, did not induce histamine
release even at 10-2 µg/ml (Fig. 6
A).
|
5-fold more
IgE Abs than the rPhl p 5A fragment and was
1000-fold more active in
inducing basophil histamine release (Fig. 6
53%, a maximal histamine release of no more than 32%
was achieved by rPhl p 6 (Fig. 6rPhl p 5A and the rPhl p 5A fragment induce immediate type skin reactions in grass pollen-allergic patients
To further investigate the in vivo allergenic activity of rPhl p
5A and the rPhl p 5A fragment, skin prick tests were performed (Table III
). Three grass pollen-allergic patients and one nonallergic
individual were skin prick tested with five concentrations of purified
rPhl p 5A fragment and with the complete rPhl p 5A allergen. In all
grass pollen-allergic patients, but not in the nonallergic individual,
all concentrations of the rPhl p 5A fragment, as well as of the
complete allergen, induced immediate type skin reactions (Table III
).
The recombinant Phl p 5A fragment elicited skin reactions that were
similar (A) or sometimes even stronger (B, C) than those elicited by
complete rPhlp 5A over the whole range of concentrations in all three
grass pollen-allergic patients. Timothy grass and birch pollen extract
elicited immediate type skin reactions in the sensitized patients but
not in the nonatopic individual. Histamine elicited a wheal reaction in
all three atopic and in the nonallergic person.
| Discussion |
|---|
|
|
|---|
When we analyzed the rPhl p 5A fragment by CD, we found that the
allergen domain consisted exclusively of
helical secondary
structure, in agreement with the secondary structure prediction and
preliminary nuclear magnetic resonance analysis of the isolated protein
module. In fact, nuclear magnetic resonance analysis of the rPhl p 5A
domain indicates that it consists of four
helical bundles that are
connected by short loops on top (A. Pastore and R. Valenta, unpublished
data). Although the secondary structure of the rPhl p 5A domain differs
from that of several other allergens analyzed to date (reviewed in
5, 6), the protein module as well as the complete rPhl p
5A allergen showed a remarkable tendency to refold after thermal
denaturation. The ability to refold after denaturation was also
reported for several other important allergens from plants and fish
(12, 13, 15, 22, 23, 24, 25). Therefore, stability and
refolding capacity may be relevant features of potent allergens as they
may facilitate the survival of these proteins in the environment and in
the target organs of atopy and thus allow them to elicit and maintain
allergic immune responses. This assumption would be also supported by
the finding that food allergens exhibit high resistance against low pH
and digestive enzymes (52).
The rPhl p 5A fragment represents an important allergenic protein
domain because it was recognized by IgE of almost 80% of grass
pollen-allergic patients. Several experiments suggest that the rPhl p
5A domain contains several IgE epitopes and thus exhibits high
allergenic activity. Quantitative IgE binding experiments showed that
the rPhl p 5A fragment bound between 7.8 and 51.1% (mean: 24%) of Phl
p 5A-specific IgE Abs. In addition to the IgE Fab-defined epitope,
several other IgE epitopes must be present on the rPhl p 5A fragment
because neither the IgE Fab nor a complete recombinant bivalent IgG1
Ab, obtained by genetic engineering of the Fab-derived variable regions
to IgG1 constant domains, inhibited significantly IgE anti-rPhl p
5A fragment reactivity. Both competitors were used in excess to IgE but
achieved only moderate inhibition (Fab: 11.1%; IgG1: 22.9%) of IgE
binding to the fragment, whereas polyclonal IgG inhibited IgE binding
almost completely (Table II
). The presence of several other
cross-reactive IgE epitopes on the domain also explains why the
deletion of the corresponding domain from the Phl p 5B isoform, which
was not recognized by the Fab, strongly reduced the IgE binding
capacity and allergenic activity of Phl p 5B (53).
Although the rPhl p 5A fragment comprised only approximately
one-third of the complete rPhl p 5A allergen we found that the
recombinant allergen domain exhibited high allergenic activity when
tested for its capacity to elicit histamine release from basophils as
well as immediate type skin reactions. The rPhl p 5A fragment accounted
only for
20% of the complete allergens IgE binding capacity but
elicited comparable immediate skin reactions in all three grass
pollen-allergic patients. We chose the basophil histamine release assay
to evaluate the allergenic activity of the rPhl p 5A fragment in more
detail for two reasons 1) serum-derived IgG Abs or factors are less
likely to influence the release of histamine from isolated granulocytes
than skin reactions; and 2) for the in vitro histamine release
tests, allergens can be diluted to extremely low concentrations in
protein-containing buffers avoiding loss of allergen due to adsorption
to the tubes.
The rPhl p 5A fragment induced histamine release already at very
low concentrations (10-12 µg/ml).
Interestingly, we found that the fragment induced in one donor (Fig. 6
A) histamine release at a lower concentration than the
complete allergen. The latter finding is in agreement with a previous
study reporting that proteolytic cleavage of Phl p 5 in nasal
secretions increased the allergenic activity of the molecule
(40).
As yet we cannot provide a definitive explanation for the high
allergenic potency of the rPhl p 5A allergen domain, but the
possibility that aggregation of the fragment might have been
responsible for the strong biological activity seems unlikely because
neither CD measurements nor native PAGE and gel filtration provided
evidence for the formation of aggregates. Alternatively we suggest that
a favorable arrangement/geometry of IgE epitopes on the rPhl p 5A
domain may be responsible for the efficient cell activation. In this
context it has been reported that cross-linking of only a small
proportion of effector cell-bound IgE can yield maximal responses
(54). Furthermore, it has been shown that upon
cross-linking the high affinity IgE receptor becomes associated with
rafts, representing membrane microdomains (55, 56, 57). Thus
it may be speculated that optimal structural arrangement of IgE
epitopes contributes to highly efficient cross-linking of Fc
RI and
influences membrane clustering and signal transduction.
In conclusion, we suggest the rPhl p 5A domain together with its corresponding IgE Fab as paradigmatic tools for the analysis of structural requirements for highly efficient effector cell activation. This example may perhaps also teach us general strategies to inactivate the allergenic activity of major allergens and retain their immunogenicity for specific immunotherapy.
| Footnotes |
|---|
2 Address correspondence and reprint requests to Dr. Rudolf Valenta, Department of Pathophysiology, AKH, University of Vienna, Waehringer Guertel 18-20, A-1090 Vienna, Austria. ![]()
3 Abbreviations used in this paper: CD, circular dichroism; AP, alkaline phosphatase; IPTG, isopropyl-ß-thiogalactopyranoside; RAST, 125I-labeled anti-human IgE Abs. ![]()
Received for publication July 21, 1999. Accepted for publication July 5, 2000.
| References |
|---|
|
|
|---|
RI case. Immunol. Today 14:222.[Medline]
RI-mediated recruitment of p53/56lyn to detergent-resistant membrane domains accompanies cellular signalling. Proc. Natl. Acad. Sci. USA 92:9201.
RI with detergent-resistant membranes. J. Biol. Chem. 274:1753.This article has been cited by other articles:
![]() |
M. Li, A. Gustchina, J. Alexandratos, A. Wlodawer, S. Wunschmann, C. L. Kepley, M. D. Chapman, and A. Pomes Crystal Structure of a Dimerized Cockroach Allergen Bla g 2 Complexed with a Monoclonal Antibody J. Biol. Chem., August 15, 2008; 283(33): 22806 - 22814. [Abstract] [Full Text] [PDF] |
||||
![]() |
B. Linhart, S. Bigenzahn, A. Hartl, C. Lupinek, J. Thalhamer, R. Valenta, and T. Wekerle Costimulation Blockade Inhibits Allergic Sensitization but Does Not Affect Established Allergy in a Murine Model of Grass Pollen Allergy J. Immunol., March 15, 2007; 178(6): 3924 - 3931. [Abstract] [Full Text] [PDF] |
||||
![]() |
I. Rauter, M.-T. Krauth, S. Flicker, A. Gieras, K. Westritschnig, S. Vrtala, N. Balic, S. Spitzauer, J. Huss-Marp, K. Brockow, et al. Allergen cleavage by effector cell-derived proteases regulates allergic inflammation FASEB J, May 1, 2006; 20(7): 967 - 969. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. Karisola, J. Mikkola, N. Kalkkinen, K. J. Airenne, O. H. Laitinen, S. Repo, O. T. Pentikainen, T. Reunala, K. Turjanmaa, M. S. Johnson, et al. Construction of Hevein (Hev b 6.02) with Reduced Allergenicity for Immunotherapy of Latex Allergy by Comutation of Six Amino Acid Residues on the Conformational IgE Epitopes J. Immunol., February 15, 2004; 172(4): 2621 - 2628. [Abstract] [Full Text] [PDF] |
||||
![]() |
O. Maglio, J. W. Saldanha, S. Vrtala, S. Spitzauer, R. Valenta, and A. Pastore A major IgE epitope-containing grass pollen allergen domain from Phl p 5 folds as a four-helix bundle Protein Eng. Des. Sel., August 1, 2002; 15(8): 635 - 642. [Abstract] [Full Text] [PDF] |
||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |