|
|
||||||||



*
Gwen Knapp Center for Lupus and Immunology, University of Chicago, Chicago, IL 60637; and
Abramson Family Cancer Research Institute, University of Pennsylvania Cancer Center, Philadelphia, PA 19104
| Abstract |
|---|
|
|
|---|
CTLA-4 tail), or a CTLA-4
Tyr201 mutant (Y201V) were introduced into CTLA-4-deficient
mice. CTLA-4-/- mice display an autoimmune
lymphoproliferative disorder resulting in tissue destruction and early
death. When either the FL or the Y201V transgene was bred into
CTLA-4-/- animals, a complete rescue from
lymphoproliferation and autoimmunity was observed. In contrast,
CTLA-4-/- mice expressing the
CTLA-4 tail transgene
were long lived with no evidence of multiorgan lymphocytic
infiltration, but exhibited lymphadenopathy and accumulated large
numbers of activated T cells. Furthermore, these animals displayed a
Th2-biased phenotype which conferred susceptibility to
Leishmania infection. These results indicate that the
inhibitory effect of CTLA-4 is mediated in part through the ability of
the extracellular domain to compete for ligands. The cytoplasmic domain
of CTLA-4, however, is required for complete inhibitory function of the
receptor and for regulation of Th cell differentiation in
vivo. | Introduction |
|---|
|
|
|---|
How CTLA-4-mediated inhibition is accomplished has not been well defined. One proposed mechanism is through competition for ligand by the extracellular domain of CTLA-4. CTLA-4 binds the same ligands as CD28 but has been found to bind with higher affinity (27, 28, 29). CTLA-4 may function by sequestering surface B7 ligands, thus preventing CD28 signaling. The cytoplasmic domain of CTLA-4, however, has been found to be 100% conserved between species, suggesting that this domain is important for CTLA-4 function. Several studies have suggested that CTLA-4 may possess signaling capabilities that antagonize signal transduction delivered through either CD28 and/or the TCR (30, 31, 32). Alternatively, CTLA-4 may function by sequestering cytoplasmic signaling molecules via its cytoplasmic domain. These mechanisms are not mutually exclusive and a combination may be employed to exert the inhibitory effect of CTLA-4.
CTLA-4 has a short 36-aa cytoplasmic tail that contains two
tyrosine-based motifs. The YVKM motif at Tyr201
(Y201) has been shown to regulate the association of CTLA-4 with
cytoplasmic signaling molecules as well as with proteins that control
intracellular trafficking. The phosphorylated form of YVKM is reported
to associate with phosphatidylinositol 3-kinase (30) and
the Src homology 2 containing tyrosine phosphatase-2 (32, 33). Recent studies also provide evidence for the association
between CTLA-4 and the CD3-
chain of the TCR and suggest that CTLA-4
may interfere with early TCR signaling events (32).
The cell surface expression and intracellular trafficking of CTLA-4 is highly regulated (34, 35, 36). CTLA-4 is undetectable on the surface of naive T cells and is induced upon activation. Even upon maximal induction, however, the majority of CTLA-4 is found inside the cell. This intracellular localization is due in part to the rapid internalization of cell surface CTLA-4. The Y201 YVKM motif forms a consensus tyrosine-based sorting motif that mediates the interaction with the clathrin-associated adapter complex AP-2, which regulates endocytosis at the plasma membrane. This same YVKM motif has also been found to associate with the clathrin adapter complex AP-1, which appears to shuttle excess CTLA-4 from the Golgi to lysosomal compartments for degradation (37). Mutation of Tyr201 inhibits internalization and results in increased levels of CTLA-4 on the cell surface (38). Whereas the association of CTLA-4 with phosphatidylinositol 3-kinase and Src homology 2 containing tyrosine phosphatase 2 has been reported to depend upon tyrosine phosphorylation of CTLA-4 Y201 (30, 33), phosphorylation of this tyrosine abrogates AP-2 binding (39, 40, 41). Y201, therefore, has the potential to regulate both trafficking and signal transduction of CTLA-4 by binding in the unphosphorylated state to clathrin-associated complexes and upon phosphorylation providing a docking site for the recruitment of cytoplasmic signaling molecules (1).
To address the question of how CTLA-4-mediated inhibition is achieved
in vivo, we produced mice expressing either the full-length CTLA-4
receptor (FL), a receptor consisting of the CTLA-4 extracellular and
transmembrane domains without the cytoplasmic domain (
CTLA-4 tail),
or a mutant form of CTLA-4 in which Y201 had been replaced by valine
(Y201V). These animals were then bred to homozygosity for a null
mutation at the endogenous ctla-4 locus to assess the
capability of the transgene-encoded proteins to rescue the
CTLA-4-deficient phenotype. Complementation with either the FL
transgene or the Y201V transgene appeared to provide for a complete
rescue of the CTLA-4-deficient phenotype. Mice expressing the
CTLA-4
tail transgene retained the lymphadenopathy defect and accumulated
large numbers of activated T cells with age, but showed no evidence of
multiorgan lymphocytic infiltration and had a normal life span.
Furthermore, these mice displayed a Th2-biased phenotype. These results
indicate that a partial contribution of CTLA-4 in regulating the immune
response occurs in the absence of the cytoplasmic domain of CTLA-4,
suggesting that the inhibitory effect of CTLA-4 is mediated in part
through the ability of the extracellular domain to compete for ligands.
The cytoplasmic domain of CTLA-4, however, is required for complete
inhibitory function of the receptor. These data also provide novel in
vivo evidence of the critical role of CTLA-4 in regulating Th cell
differentiation.
| Materials and Methods |
|---|
|
|
|---|
Transgenic constructs were made by ligating the
HindIII/XbaI fragment of
pcDNA3 CTLA-4 or pcDNA3 CTLA-4 Y201V (38) or the
HindIII/XhoI fragment of pcDNA3 CTLA-4
tail
(42) into the AscI site of the vector pLckE.2.
The pLckE.2 vector was provided by Drs. T. Hettmann and J. Leiden
(Harvard Medical School) and contains the proximal Lck promoter
(43) and the CD2 enhancer (44). CTLA-4
sequences and mutations were confirmed by DNA sequencing. A downstream
in-frame stop codon contained within the transgene vector was utilized
in the pLckE.2 CTLA-4
tail construct, resulting in the replacement
of the CTLA-4 residues 191223 with the amino acids
STRQDPKAQLPEPLRVLWTAHLAAMATGKRP. Transgene DNA was microinjected
into the male pronucleus of fertilized single-cell embryos of CD1 mice.
Microinjected eggs were transferred to pseudopregnant CD1 foster
mothers. Transgene integration was determined by Southern blot analysis
and by PCR using standard techniques. Expression of CTLA-4 protein on T
cells was analyzed by flow cytometry using PE-conjugated
anti-CTLA-4 Ab (PharMingen, San Diego, CA). The absence of the
CTLA-4 cytoplasmic domain in the
CTLA-4 tail strain was confirmed by
the lack of detectable CTLA-4 protein on Western blot analysis using
the polyclonal Ab C-19 that recognizes the CTLA-4 carboxyl terminus
(Santa Cruz Biotechnology, Santa Cruz, CA). Western blotting using a
polyclonal Ab that recognizes the CTLA-4 extracellular domain (Q20;
Santa Cruz Biotechnology) detected the presence of CTLA-4 protein that
migrated with an apparent molecular mass of 45 kDa.
Transgenic mice (Tg+CTLA4+/+) were bred to Rag-/-CTLA-4-/- mice (129 x C57BL/6), a generous gift from Dr. M. Alegre (University of Chicago), and resulting Tg+Rag-/+ mice were bred to CTLA-4+/- mice that had been crossed at least six times to the C57BL/6 strain to generate Tg+CTLA-4-/- mice. Tg+CTLA-4-/- were bred onto the C57BL/6 background for two to six generations.
For histological studies, tissues were fixed in 10% Formalin and embedded in paraffin. Sections were stained with hematoxylin and eosin using standard techniques.
In vitro stimulation and detection of CTLA-4 expression
Spleens were harvested and single-cell suspensions depleted of erythrocytes were prepared as described previously (36). Cells were grown in the presence of soluble 145-2C11 (0.1 µg/ml) and PV-1 (1 µg/ml) for the indicated times. Cell surface and intracellular CTLA-4 expression were detected by flow cytometry as described previously (42).
Cell surface staining
To assess the activation status of T cells, spleen and lymph node cells were stained with FITC-conjugated anti-CD8 and Cy-Chrome (CyC)5-conjugated anti-CD4 and a panel of PE-conjugated Abs including anti-CD25, anti-CD69, anti-CD44, anti-CD45RB, and anti-CD62L. To assess the activation status of B cells, spleen and lymph node cells were double-stained with CyC-conjugated anti-B220 and PE-conjugated anti-B7-1, anti-B7-2, or anti-class II IAb. All Abs were purchased from PharMingen (San Diego, CA). Stained cells were analyzed on a FACSort or a FACSCalibur (Becton Dickinson, Mountain View, CA).
Quantitation of serum Ig levels
Serum was collected from unimmunized 4-wk-old mice and analyzed by ELISA using commercial mAb pairs (PharMingen) according to the manufacturers instructions.
Keyhole limpet hemocyanin (KLH) injections
Mice were immunized in the hind footpads with 5 µg KLH
(Calbiochem, San Diego, CA) precipitated in alum. Nine days after
immunizations, draining popliteal lymph nodes were harvested and
single-cell suspensions were prepared in DMEM (supplemented with 10%
FCS, 2 mM glutamine, 50 mM HEPES (pH 7.5), 100 U/ml penicillin, 100
µg/ml streptomycin, and 50 µM 2-ME). For ex vivo stimulations,
5 x 105 cells were cultured in either media
alone or with the addition of KLH at 100 µg/ml. Supernatants were
harvested at 48 h and analyzed for IL-4 and IFN-
by ELISA using
commercial mAb pairs (PharMingen) according to the manufacturers
instructions.
Leishmania infections
Infections were performed as described previously (45). In brief, wild-type or transgenic mice were injected in both hind footpads with 1 x 106 (for one experiment) or 5 x 105 (for second experiment) metacyclic promastigotes of Leishmania major (WHOM/IR/-/173). Lesion size was determined by measuring footpads with a metric caliper. After 58 wk, draining popliteal lymph nodes were collected and stimulated in vitro with soluble Leishmania Ag and analyzed for cytokine production as described previously (45). Parasite burden was determined as described previously (45). The response of mice of mixed CD1/C57BL/6 genetic background to infection with Leishmania is comparable to that of wild-type C57BL/6 mice (S. L. Reiner, unpublished observations).
| Results |
|---|
|
|
|---|
T cell inhibition that is induced by CTLA-4 may be achieved
through competition for CD28 ligands; in addition, the cytoplasmic
domain of CTLA-4 may mediate CTLA-4 signal transduction. To determine
the relative contributions of the different CTLA-4 domains to
CTLA-4-inhibitory function in vivo, transgenic mice were generated that
expressed either 1) full-length CTLA-4, 2) a CTLA-4 mutant in which the
CTLA-4 cytoplasmic domain is replaced by random amino acids, or 3) a
CTLA-4 mutant containing a valine substitution at
Tyr201. The transgenes were expressed in mice
under the regulation of the proximal Lck promoter and CD2 enhancer
(Fig. 1
A), and integration of
the transgene was assessed by Southern blot analysis (data not shown).
Constitutive expression of CTLA-4 transgenes was not observed to have
gross physiological consequences in wild-type mice. Founders were then
bred to homozygosity for the ctla-4 null mutation
(19).
|
CTLA-4 tail transgene, low levels of CTLA-4 were
detected on the cell surface of CD3+ lymph node
cells, as indicated by a consistently higher mean fluorescence
intensity compared with that obtained for cells from wild-type mice. In
contrast, in mice expressing the Y201V mutant, higher levels of CTLA-4
were detected on the cell surface. Expression of all three transgenes
was readily detected intracellularly (Fig. 1
CTLA-4 tail mutant, which also lacks Y201, did not exhibit a
similar increase in expression. This suggests that other residues
within the CTLA-4 cytoplasmic domain are important for normal
trafficking of CTLA-4 to the plasma membrane and/or its stable
accumulation on the cell surface. Expression of transgene-encoded CTLA-4 upon T cell activation
In wild-type animals, CTLA-4 is not expressed on naive T cells but
is induced upon T cell activation. To examine the effect of T cell
stimulation on transgene-encoded CTLA-4 surface expression, splenocytes
were stimulated with soluble anti-CD3 plus anti-CD28 and
examined by flow cytometry for CTLA-4 expression on both
CD4+ and CD8+ T cell
subsets. CD4+ and CD8+
splenocytes from FL/CTLA-4-/- mice exhibited
low but constitutive CTLA-4 surface expression that did not change with
T cell activation (Fig. 2
A and
data not shown). CD4+ and
CD8+ splenocytes from
CTLA-4
tail/CTLA-4-/- and
Y201V/CTLA-4-/- mice showed increased
expression of surface CTLA-4 with stimulation, displaying similar
kinetics compared with wild-type cells (Fig. 2
, B and
C). Surface expression levels on cells isolated from
CTLA-4 tail/CTLA-4-/- mice reached similar
levels as detected on wild-type cells (Fig. 2
B). Surface
expression levels on cells isolated from
Y201V/CTLA-4-/- mice reached 10 times higher
geometric mean fluorescence intensity compared with wild-type cells
(Fig. 2
C).
|
CTLA-4
tail/CTLA-4-/-, and
Y201V/CTLA-4-/- mice showed similar kinetics of
expression compared with wild-type cells (Fig. 2
CTLA-4 tail/CTLA-4-/- and
Y201V/CTLA-4-/- mice obtained higher levels and
cells from FL/CTLA-4-/- mice obtained lower
levels of peak expression compared with wild-type cells. Similar to
what was seen in wild-type cells, expression of CTLA-4 on
CD8+ cells, both surface and total, from each of
the transgenic animals mirrored that detected on
CD4+ cells but with slightly higher levels of
expression (data not shown). Effect on lethality
CTLA-4 deficiency results in a lethal phenotype with death
occurring at
34 wk of age. CTLA-4-/-
animals bearing the FL transgene or the Y201V transgene were completely
rescued from early lethality. FL/CTLA-4-/- and
Y201V/CTLA-4-/- mice lived well into adulthood
and reproduced normally.
CTLA-4
tail/CTLA-4-/- mice also lived into adulthood
and reproduced normally. A second founder expressing lower levels of
the
CTLA-4 tail transgene also showed prolonged survival, although
most of these animals ultimately succumbed to lymphoproliferative
disease. Thus, the ability of the
CTLA-4 tail transgene to rescue
the lethality of the disease correlated with the level of the
CTLA-4
tail receptor detected on the surface of CD4+ T
cells. Experiments shown are from animals derived from the founder that
expressed higher levels of the
CTLA-4 tail transgene.
Effect on homeostasis and accumulation of activated T cells
In addition to early death, CTLA-4-deficient mice display
splenomegaly and lymphadenopathy with the number of lymphocytes in the
spleen and lymph nodes reaching 5- to 10-fold higher numbers compared
with wild-type animals (19, 20). The presence of the FL or
Y201V transgene corrected this defect (Fig. 3
). In contrast, lymph nodes (but not
spleens) from
CTLA-4 tail/CTLA-4-/- animals
showed increasing numbers of cells with age, achieving 10-fold higher
numbers compared with age-matched wild-type controls.
|
CTLA-4
tail/CTLA-4-/-, and
Y201V/CTLA-4-/- mice maintained a naive T cell
phenotype and displayed normal percentages of
CD4+, CD8+, and
B220+ cells (data not shown). At 2 mo of age,
FL/CTLA-4-/- and
Y201V/CTLA-4-/- mice still maintained a naive
phenotype, as increased expression of the activation markers CD25 and
CD69 was not detected in T cells from these mice. In contrast, 2-mo-old
CTLA-4 tail/CTLA-4-/- mice displayed an
increase in both the percentage and absolute numbers of
CD4+ lymph node cells expressing increased levels
of the activation markers CD25, CD69, or CD44 and decreased levels of
CD45RB and CD62L (Fig. 4
CTLA-4 tail/CTLA-4-/- mice
displaying activation markers was also increased (data not shown).
|
CTLA-4 tail/CTLA-4-/- mice, there was no
evidence of mononuclear infiltrates in any of the organs analyzed (Fig. 5
|
CTLA-4 tail/CTLA-4-/- mice display a Th2-biased
phenotype
In addition to accumulation of activated T cells,
CTLA-4
tail/CTLA-4-/- mice also showed in vivo
activation of B cells as determined by the up-regulation of MHC class
II and B7-2 molecules (data not shown).
FL/CTLA-4-/- and
Y201V/CTLA-4-/- mice exhibited normal
percentages of activated B cells. To quantitate basal Ig isotype
levels, we analyzed sera from unimmunized wild-type mice,
CTLA-4-/- mice, and the three different
Tg+/CTLA-4-/- lines by
ELISA. Compared with wild-type mice, CTLA-4-/-
animals showed increased levels of IgG1, IgG2a, and IgE (data not shown
and Ref. 19), whereas there was no difference in the
levels of these Igs between wild-type and
FL/CTLA-4-/- or
Y201V/CTLA-4-/- mice (Fig. 6
). In contrast,
CTLA-4
tail/CTLA-4-/- mice had significantly higher
levels of only the IL-4-dependent Igs IgG1 and IgE and had lower levels
of the IFN-
-dependent Ig IgG2a compared with wild-type mice (Fig. 6
), indicative of a Th2-biased phenotype.
|
CTLA-4
tail/CTLA-4-/- mice reflected a feature of an
in vivo Ag-specific immune response, we immunized mice with KLH
precipitated in alum. Nine days later, draining lymph node cells were
restimulated with KLH in vitro and the cytokine profile was determined
(Fig. 7
compared with cultures from
wild-type mice. Cultures from Y201V/CTLA-4-/-
mice were variable, sometimes displaying similar levels of IL-4 and
IFN-
compared with wild-type cultures and sometimes showing higher
levels of both IL-4 and IFN-
. In contrast, cultures from
CTLA-4
tail/CTLA-4-/- mice consistently produced
greatly elevated levels of IL-4 compared with wild-type cultures and
low to undetectable levels of IFN-
, indicative of an enhanced Th2
response. The differences in cytokine production were not due to
differences in proliferative capacity because lymph node cells isolated
from transgenic and wild-type mice rechallenged with graded doses of
KLH or a control Ag demonstrated similar proliferative responses (data
not shown).
|
CTLA-4 tail/CTLA-4-/- mice are susceptible to
infection with L. major
Th cells from
CTLA-4 tail/CTLA-4-/-
mice appear to skew toward a Th2 pathway as evidenced in elevated
production of the Th2 cytokine IL-4 by effector cells ex vivo and
increased production of the IL-4-dependent Igs IgG1 and IgE. To
determine whether this bias in differentiation resulted in
physiological consequences in vivo, mice were injected in the hind
footpads with the intracellular pathogen L.
major. Control of this disease is dependent on the
successful development of Th1 cells and their production of IFN-
,
which is required to activate macrophage-mediated clearance of the
parasite (46). Strains that are genetically predisposed to
produce a Th1 response, such as the C57BL/6 and CD1 strains, are able
to control the disease. IL-4 production by Th2 cells negatively
regulates macrophage-activated clearing and, therefore, strains such as
BALB/c that are genetically predisposed to develop a Th2 response are
susceptible to the disease.
The course of infection was monitored by measuring the size of the
local lesions (Fig. 8
A).
Wild-type C57BL/6 mice were capable of controlling the infection, with
the initial slight swelling of the injected footpads being followed by
resolution of the lesions. BALB/c mice were unable to control the
infection and developed progressive enlargement of their footpads.
FL/CTLA-4-/- and
Y201V/CTLA-4-/- mice were capable of
controlling the infection, showing resolution of their lesions. In
contrast,
CTLA-4 tail/CTLA-4-/- mice were
unable to control the infection and demonstrated progressive
enlargement of their footpad lesions. Parasite cultures from the feet
and spleens of the infected mice confirmed that
FL/CTLA-4-/- and
Y201V/CTLA-4-/- mice had resolved the
infection, whereas
CTLA-4 tail/CTLA-4-/-
mice had not (data not shown).
|
. In contrast,
susceptible mice, including
CTLA-4
tail/CTLA-4-/- mice, produced high levels of
IL-4. Addition of an anti-MHC class II Ab resulted in undetectable
levels of cytokines in all cultures, demonstrating that class
II-restricted helper T cells were mediating these effects (data not
shown). These data confirmed that increased susceptibility of
CTLA-4
tail/CTLA-4-/- mice to L. major
infection correlates with increased production of IL-4. | Discussion |
|---|
|
|
|---|
CTLA-4
tail transgene still developed autoimmunity but with delayed onset.
However, even when the mutant receptor lacking the CTLA-4 cytoplasmic
domain is expressed at levels comparable to endogenous CTLA-4 on
wild-type cells, the rescue of the CTLA-4-/-
phenotype is incomplete. These data suggest that CTLA-4 ligand binding
alone is not sufficient to account for the ability of CTLA-4 to
suppress ongoing T cell activation and accumulation. The highest levels of constitutive and inducible CTLA-4 expression were observed with the CTLA-4 Y201V animals. These animals also displayed a complete rescue of the CTLA-4-/- phenotype, suggesting that Y201 may not be absolutely required for CTLA-4 function. However, since mutation of Y201 results in greatly increased levels of CTLA-4 on the cell surface, it is possible that this increase in CTLA-4 surface expression can compensate for any defect due to a lack of Y201. CTLA-4 has been proposed to suppress the activation of resting cells, therefore inducing anergy or increasing the threshold of T cell activation. Both FL CTLA-4 and Y201V CTLA-4 are expressed in freshly isolated cells at levels that are reproducibly higher than wild-type cells; nevertheless, these animals are able to mount a curative immune response to leishmaniasis. Thus, constitutive CTLA-4 expression does not prevent activation of naive T cells to pathogens even when expressed at supraphysiological levels.
We have found that the CTLA-4 cytoplasmic domain plays an important role in the regulation of T cell activation and Th cell differentiation. Although an initial characterization of the CTLA-4-/- mice did not find a skewing toward either a Th1 or Th2 phenotype (20), recent in vitro studies have suggested that a lack of CTLA-4 function may predispose activated T cells toward Th2 development (47, 48). The studies presented here provide an in vivo demonstration of the critical role of CTLA-4 in regulating the Th1/Th2 balance and show that the Th2 skewing in these mice is physiologically relevant. Furthermore, our data suggest that this skewing alone is insufficient to result in autoimmune organ dysfunction and that additional mechanisms must exist for manifestation of the full CTLA-4-deficient phenotype. The molecular basis for the regulation of Th differentiation by CTLA-4 is not known, but may be due to the induction of specific transcription factors that regulate Th cell development upon CTLA-4 activation (49) and/or an effect of CTLA-4 on cell cycle progression and cell division (50).
In summary, these studies suggest that the inhibitory effect of CTLA-4
is mediated in part by competition for B7 ligands but that the
cytoplasm domain of CTLA-4 is required for full inhibitory function.
These data also provide in vivo evidence that CTLA-4 plays a role in
regulating the Th1/Th2 balance. The
CTLA-4
tail/CTLA-4-/- animals displayed evidence of a
progressive systemic involvement of Th2 cells and responded to in vivo
challenge with a Th2-biased response. Since this phenotype is corrected
by the FL and Y201V transgenes, the data suggest that the CTLA-4
cytoplasmic domain is contributing to the regulation of Th1/Th2
balance. This could occur through its ability to initiate signal
transduction or as a result of its ability to localize CTLA-4 to
specific sites during T cell activation. These data support that
residues in addition to Tyr201 play a critical
role in regulating the activity of CTLA-4.
| Acknowledgments |
|---|
| Footnotes |
|---|
2 E.L.M. and E.C. contributed equally to this work. ![]()
3 Dr. Ellen Chuang at her current address: Department of Medicine, Division of Hematology/Oncology, Weill Medical College of Cornell University, 525 East 68th Street, New York, NY 10021. ![]()
4 Address correspondence and reprint requests to Dr. Emma L. Masteller at her current address: Ben May Institute for Cancer Research, 5841 South Maryland Avenue, MC 1089, Chicago, IL 60637. ![]()
5 Abbreviations used in this paper: CyC, Cy-Chrome; KLH, keyhole limpet hemocyanin. ![]()
Received for publication November 2, 1999. Accepted for publication March 3, 2000.
| References |
|---|
|
|
|---|
and ZAP70. J. Exp. Med. 186:1645.
/CD3 complex, but not CD28, interact with clathrin adaptor complexes AP-1 and AP-2. J. Immunol. 163:1868.This article has been cited by other articles:
![]() |
M. Araki, D. Chung, S. Liu, D. B. Rainbow, G. Chamberlain, V. Garner, K. M. D. Hunter, L. Vijayakrishnan, L. B. Peterson, M. Oukka, et al. Genetic Evidence That the Differential Expression of the Ligand-Independent Isoform of CTLA-4 Is the Molecular Basis of the Idd5.1 Type 1 Diabetes Region in Nonobese Diabetic Mice J. Immunol., October 15, 2009; 183(8): 5146 - 5157. [Abstract] [Full Text] [PDF] |
||||
![]() |
J.-M. Choi, S.-H. Kim, J.-H. Shin, T. Gibson, B.-S. Yoon, D.-H. Lee, S.-K. Lee, A. L. M. Bothwell, J.-S. Lim, and S.-K. Lee Transduction of the cytoplasmic domain of CTLA-4 inhibits TcR-specific activation signals and prevents collagen-induced arthritis PNAS, December 16, 2008; 105(50): 19875 - 19880. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. D. Taylor, A. Harris, S. A. Babayan, O. Bain, A. Culshaw, J. E. Allen, and R. M. Maizels CTLA-4 and CD4+CD25+ Regulatory T Cells Inhibit Protective Immunity to Filarial Parasites In Vivo J. Immunol., October 1, 2007; 179(7): 4626 - 4634. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. Hryniewicz, A. Boasso, Y. Edghill-Smith, M. Vaccari, D. Fuchs, D. Venzon, J. Nacsa, M. R. Betts, W.-P. Tsai, J.-M. Heraud, et al. CTLA-4 blockade decreases TGF-beta, IDO, and viral RNA expression in tissues of SIVmac251-infected macaques Blood, December 1, 2006; 108(12): 3834 - 3842. [Abstract] [Full Text] [PDF] |
||||
![]() |
H. Schneider, J. Downey, A. Smith, B. H. Zinselmeyer, C. Rush, J. M. Brewer, B. Wei, N. Hogg, P. Garside, and C. E. Rudd Reversal of the TCR Stop Signal by CTLA-4 Science, September 29, 2006; 313(5795): 1972 - 1975. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. J. Engelhardt, T. J. Sullivan, and J. P. Allison CTLA-4 Overexpression Inhibits T Cell Responses through a CD28-B7-Dependent Mechanism J. Immunol., July 15, 2006; 177(2): 1052 - 1061. [Abstract] [Full Text] [PDF] |
||||
![]() |
L M Amezcua-Guerra, B Hernandez-Martinez, C Pineda, and R Bojalil Ulcerative colitis during CTLA-4Ig therapy in a patient with rheumatoid arthritis Gut, July 1, 2006; 55(7): 1059 - 1060. [Full Text] [PDF] |
||||
![]() |
S. G. Zheng, J. H. Wang, W. Stohl, K. S. Kim, J. D. Gray, and D. A. Horwitz TGF-beta Requires CTLA-4 Early after T Cell Activation to Induce FoxP3 and Generate Adaptive CD4+CD25+ Regulatory Cells J. Immunol., March 15, 2006; 176(6): 3321 - 3329. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Homann, W. Dummer, T. Wolfe, E. Rodrigo, A. N. Theofilopoulos, M. B. A. Oldstone, and M. G. von Herrath Lack of Intrinsic CTLA-4 Expression Has Minimal Effect on Regulation of Antiviral T-Cell Immunity J. Virol., January 1, 2006; 80(1): 270 - 280. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. J. Salmond, G. Huyer, A. Kotsoni, L. Clements, and D. R. Alexander The src Homology 2 Domain-Containing Tyrosine Phosphatase 2 Regulates Primary T-Dependent Immune Responses and Th Cell Differentiation J. Immunol., November 15, 2005; 175(10): 6498 - 6508. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. V. Parry, J. M. Chemnitz, K. A. Frauwirth, A. R. Lanfranco, I. Braunstein, S. V. Kobayashi, P. S. Linsley, C. B. Thompson, and J. L. Riley CTLA-4 and PD-1 Receptors Inhibit T-Cell Activation by Distinct Mechanisms Mol. Cell. Biol., November 1, 2005; 25(21): 9543 - 9553. [Abstract] [Full Text] [PDF] |
||||
![]() |
H. Schneider, E. Valk, S. da Rocha Dias, B. Wei, and C. E. Rudd CTLA-4 up-regulation of lymphocyte function-associated antigen 1 adhesion and clustering as an alternate basis for coreceptor function PNAS, September 6, 2005; 102(36): 12861 - 12866. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Mukherjee, A. Ahmed, and D. Nandi CTLA4-CD80/CD86 interactions on primary mouse CD4+ T cells integrate signal-strength information to modulate activation with Concanavalin A J. Leukoc. Biol., July 1, 2005; 78(1): 144 - 157. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Chikuma, A. K. Abbas, and J. A. Bluestone B7-Independent Inhibition of T Cells by CTLA-4 J. Immunol., July 1, 2005; 175(1): 177 - 181. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. J. Dillon, K. D. Carey, S. A. Wetzel, D. C. Parker, and P. J. S. Stork Regulation of the Small GTPase Rap1 and Extracellular Signal-Regulated Kinases by the Costimulatory Molecule CTLA-4 Mol. Cell. Biol., May 15, 2005; 25(10): 4117 - 4128. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. L. Riley and C. H. June The CD28 family: a T-cell rheostat for therapeutic control of T-cell activation Blood, January 1, 2005; 105(1): 13 - 21. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. W. Hwang, W. B. Sweatt, M. Mashayekhi, D. A. Palucki, H. Sattar, E. Chuang, and M.-L. Alegre Transgenic Expression of CTLA-4 Controls Lymphoproliferation in IL-2-Deficient Mice J. Immunol., November 1, 2004; 173(9): 5415 - 5424. [Abstract] [Full Text] [PDF] |
||||
![]() |
W. Stohl, D. Xu, K. S. Kim, C. S. David, and J. P. Allison MHC class II-independent and -dependent T cell expansion and B cell hyperactivity in vivo in mice deficient in CD152 (CTLA-4) Int. Immunol., July 1, 2004; 16(7): 895 - 904. [Abstract] [Full Text] [PDF] |
||||
![]() |
L. A. Yi, S. Hajialiasgar, and E. Chuang Tyrosine-mediated inhibitory signals contribute to CTLA-4 function in vivo Int. Immunol., April 1, 2004; 16(4): 539 - 547. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Chikuma, J. B. Imboden, and J. A. Bluestone Negative Regulation of T Cell Receptor-Lipid Raft Interaction by Cytotoxic T Lymphocyte-associated Antigen 4 J. Exp. Med., January 6, 2003; 197(1): 129 - 135. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Mukherjee, P. K. Maiti, and D. Nandi Role of CD80, CD86, and CTLA4 on mouse CD4+ T lymphocytes in enhancing cell-cycle progression and survival after activation with PMA and ionomycin J. Leukoc. Biol., November 1, 2002; 72(5): 921 - 931. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Chikuma and J. A. Bluestone CTLA-4: Acting at the Synapse Mol. Interv., July 1, 2002; 2(4): 205 - 208. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. A. Chambers, J. Kang, Y. Wu, W. Held, D. H. Raulet, and J. P. Allison The lymphoproliferative defect in CTLA-4-deficient mice is ameliorated by an inhibitory NK cell receptor Blood, May 29, 2002; 99(12): 4509 - 4516. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. L. Baroja, L. Vijayakrishnan, E. Bettelli, P. J. Darlington, T. A. Chau, V. Ling, M. Collins, B. M. Carreno, J. Madrenas, and V. K. Kuchroo Inhibition of CTLA-4 Function by the Regulatory Subunit of Serine/Threonine Phosphatase 2A J. Immunol., May 15, 2002; 168(10): 5070 - 5078. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. M. Doyle, A. C. Mullen, A. V. Villarino, A. S. Hutchins, F. A. High, H. W. Lee, C. B. Thompson, and S. L. Reiner Induction of Cytotoxic T Lymphocyte Antigen 4 (Ctla-4) Restricts Clonal Expansion of Helper T Cells J. Exp. Med., October 1, 2001; 194(7): 893 - 902. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Mirshahidi, C.-T. Huang, and S. Sadegh-Nasseri Anergy in Peripheral Memory Cd4+ T Cells Induced by Low Avidity Engagement of T Cell Receptor J. Exp. Med., September 17, 2001; 194(6): 719 - 732. [Abstract] [Full Text] [PDF] |
||||
![]() |
M.-N. Avice, M. Rubio, M. Sergerie, G. Delespesse, and M. Sarfati Role of CD47 in the Induction of Human Naive T Cell Anergy J. Immunol., September 1, 2001; 167(5): 2459 - 2468. [Abstract] [Full Text] [PDF] |
||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |