The JI
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     
 


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow Request Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Masteller, E. L.
Right arrow Articles by Thompson, C. B.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Masteller, E. L.
Right arrow Articles by Thompson, C. B.
The Journal of Immunology, 2000, 164: 5319-5327.
Copyright © 2000 by The American Association of Immunologists

Structural Analysis of CTLA-4 Function In Vivo1

Emma L. Masteller2,3,*, Ellen Chuang2,3,*, Alan C. Mullen{dagger}, Steve L. Reiner{dagger} and Craig B. Thompson{dagger}

* Gwen Knapp Center for Lupus and Immunology, University of Chicago, Chicago, IL 60637; and {dagger} Abramson Family Cancer Research Institute, University of Pennsylvania Cancer Center, Philadelphia, PA 19104


    Abstract
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
CTLA-4-mediated inhibition of T cell activation may be accomplished by competition for ligands and/or by signals mediated through the intracellular domain. Studies have implicated Tyr201 in the cytoplasmic domain of CTLA-4 in regulating CTLA-4 signal transduction and intracellular trafficking. To investigate the mechanism of CTLA-4 function in vivo, transgenes encoding wild-type CTLA-4 (FL), a mutant lacking the cytoplasmic domain of CTLA-4 ({Delta}CTLA-4 tail), or a CTLA-4 Tyr201 mutant (Y201V) were introduced into CTLA-4-deficient mice. CTLA-4-/- mice display an autoimmune lymphoproliferative disorder resulting in tissue destruction and early death. When either the FL or the Y201V transgene was bred into CTLA-4-/- animals, a complete rescue from lymphoproliferation and autoimmunity was observed. In contrast, CTLA-4-/- mice expressing the {Delta}CTLA-4 tail transgene were long lived with no evidence of multiorgan lymphocytic infiltration, but exhibited lymphadenopathy and accumulated large numbers of activated T cells. Furthermore, these animals displayed a Th2-biased phenotype which conferred susceptibility to Leishmania infection. These results indicate that the inhibitory effect of CTLA-4 is mediated in part through the ability of the extracellular domain to compete for ligands. The cytoplasmic domain of CTLA-4, however, is required for complete inhibitory function of the receptor and for regulation of Th cell differentiation in vivo.


    Introduction
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
CTLA-4 (CD152) and CD28 are structurally related T cell surface molecules that possess opposing activities. Whereas CD28 is a major co-stimulatory receptor, CTLA-4 is involved in the down-regulation of the immune response (1, 2, 3). The critical role of CTLA-4 in negatively regulating T cell responses has been demonstrated in a variety of in vivo systems. Blocking Abs to CTLA-4 have been shown to augment the immune response, resulting in enhanced clearance of tumors and parasites (4, 5, 6, 7, 8, 9, 10, 11), exacerbated autoimmune disease (12, 13, 14), and enhanced allograft rejection and graft-versus-host disease (15, 16). Studies have also implicated a role for CTLA-4 in the induction of tolerance (17, 18). The most dramatic demonstration of the involvement of CTLA-4 in the negative regulation of the immune response is provided by the study of CTLA-4-deficient mice. These animals display a massive lymphoproliferative disorder accompanied by extensive lymphocytic infiltration into multiple organs, resulting in tissue destruction and death of the animals at 3–4 wk of age (19, 20, 21). CTLA-4-deficient mice display polyclonal T cell expansion with the majority of T cells exhibiting an activated phenotype. This disorder appears not to be due to a defect in thymic selection but is mediated primarily by uncontrolled activation of peripheral CD4+ cells (21, 22, 23). Activation of CTLA-4-/- T cells is dependent on CD28 stimulation as either blocking the CD28 ligands B7-1 (CD80) and B7-2 (CD86) or rendering mice deficient for B7-1 and B7-2 rescues the CTLA-4-/- phenotype (24, 25). Lymphoproliferation of T cells has been shown not to be cell autonomous since RAG-/- mice reconstituted with a mixture of normal and CTLA-4-/- bone marrow do not develop the CTLA-4-/- phenotype, demonstrating that the presence of wild-type cells can prevent the defect (26).

How CTLA-4-mediated inhibition is accomplished has not been well defined. One proposed mechanism is through competition for ligand by the extracellular domain of CTLA-4. CTLA-4 binds the same ligands as CD28 but has been found to bind with higher affinity (27, 28, 29). CTLA-4 may function by sequestering surface B7 ligands, thus preventing CD28 signaling. The cytoplasmic domain of CTLA-4, however, has been found to be 100% conserved between species, suggesting that this domain is important for CTLA-4 function. Several studies have suggested that CTLA-4 may possess signaling capabilities that antagonize signal transduction delivered through either CD28 and/or the TCR (30, 31, 32). Alternatively, CTLA-4 may function by sequestering cytoplasmic signaling molecules via its cytoplasmic domain. These mechanisms are not mutually exclusive and a combination may be employed to exert the inhibitory effect of CTLA-4.

CTLA-4 has a short 36-aa cytoplasmic tail that contains two tyrosine-based motifs. The YVKM motif at Tyr201 (Y201) has been shown to regulate the association of CTLA-4 with cytoplasmic signaling molecules as well as with proteins that control intracellular trafficking. The phosphorylated form of YVKM is reported to associate with phosphatidylinositol 3-kinase (30) and the Src homology 2 containing tyrosine phosphatase-2 (32, 33). Recent studies also provide evidence for the association between CTLA-4 and the CD3-{zeta} chain of the TCR and suggest that CTLA-4 may interfere with early TCR signaling events (32).

The cell surface expression and intracellular trafficking of CTLA-4 is highly regulated (34, 35, 36). CTLA-4 is undetectable on the surface of naive T cells and is induced upon activation. Even upon maximal induction, however, the majority of CTLA-4 is found inside the cell. This intracellular localization is due in part to the rapid internalization of cell surface CTLA-4. The Y201 YVKM motif forms a consensus tyrosine-based sorting motif that mediates the interaction with the clathrin-associated adapter complex AP-2, which regulates endocytosis at the plasma membrane. This same YVKM motif has also been found to associate with the clathrin adapter complex AP-1, which appears to shuttle excess CTLA-4 from the Golgi to lysosomal compartments for degradation (37). Mutation of Tyr201 inhibits internalization and results in increased levels of CTLA-4 on the cell surface (38). Whereas the association of CTLA-4 with phosphatidylinositol 3-kinase and Src homology 2 containing tyrosine phosphatase 2 has been reported to depend upon tyrosine phosphorylation of CTLA-4 Y201 (30, 33), phosphorylation of this tyrosine abrogates AP-2 binding (39, 40, 41). Y201, therefore, has the potential to regulate both trafficking and signal transduction of CTLA-4 by binding in the unphosphorylated state to clathrin-associated complexes and upon phosphorylation providing a docking site for the recruitment of cytoplasmic signaling molecules (1).

To address the question of how CTLA-4-mediated inhibition is achieved in vivo, we produced mice expressing either the full-length CTLA-4 receptor (FL), a receptor consisting of the CTLA-4 extracellular and transmembrane domains without the cytoplasmic domain ({Delta}CTLA-4 tail), or a mutant form of CTLA-4 in which Y201 had been replaced by valine (Y201V). These animals were then bred to homozygosity for a null mutation at the endogenous ctla-4 locus to assess the capability of the transgene-encoded proteins to rescue the CTLA-4-deficient phenotype. Complementation with either the FL transgene or the Y201V transgene appeared to provide for a complete rescue of the CTLA-4-deficient phenotype. Mice expressing the {Delta}CTLA-4 tail transgene retained the lymphadenopathy defect and accumulated large numbers of activated T cells with age, but showed no evidence of multiorgan lymphocytic infiltration and had a normal life span. Furthermore, these mice displayed a Th2-biased phenotype. These results indicate that a partial contribution of CTLA-4 in regulating the immune response occurs in the absence of the cytoplasmic domain of CTLA-4, suggesting that the inhibitory effect of CTLA-4 is mediated in part through the ability of the extracellular domain to compete for ligands. The cytoplasmic domain of CTLA-4, however, is required for complete inhibitory function of the receptor. These data also provide novel in vivo evidence of the critical role of CTLA-4 in regulating Th cell differentiation.


    Materials and Methods
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Production of CTLA-4-/- mice

Transgenic constructs were made by ligating the HindIII/XbaI fragment of pcDNA3 CTLA-4 or pcDNA3 CTLA-4 Y201V (38) or the HindIII/XhoI fragment of pcDNA3 CTLA-4 {Delta}tail (42) into the AscI site of the vector pLckE.2. The pLckE.2 vector was provided by Drs. T. Hettmann and J. Leiden (Harvard Medical School) and contains the proximal Lck promoter (43) and the CD2 enhancer (44). CTLA-4 sequences and mutations were confirmed by DNA sequencing. A downstream in-frame stop codon contained within the transgene vector was utilized in the pLckE.2 CTLA-4 {Delta}tail construct, resulting in the replacement of the CTLA-4 residues 191–223 with the amino acids STRQDPKAQLPEPLRVLWTAHLAAMATGKRP. Transgene DNA was microinjected into the male pronucleus of fertilized single-cell embryos of CD1 mice. Microinjected eggs were transferred to pseudopregnant CD1 foster mothers. Transgene integration was determined by Southern blot analysis and by PCR using standard techniques. Expression of CTLA-4 protein on T cells was analyzed by flow cytometry using PE-conjugated anti-CTLA-4 Ab (PharMingen, San Diego, CA). The absence of the CTLA-4 cytoplasmic domain in the {Delta}CTLA-4 tail strain was confirmed by the lack of detectable CTLA-4 protein on Western blot analysis using the polyclonal Ab C-19 that recognizes the CTLA-4 carboxyl terminus (Santa Cruz Biotechnology, Santa Cruz, CA). Western blotting using a polyclonal Ab that recognizes the CTLA-4 extracellular domain (Q20; Santa Cruz Biotechnology) detected the presence of CTLA-4 protein that migrated with an apparent molecular mass of 45 kDa.

Transgenic mice (Tg+CTLA4+/+) were bred to Rag-/-CTLA-4-/- mice (129 x C57BL/6), a generous gift from Dr. M. Alegre (University of Chicago), and resulting Tg+Rag-/+ mice were bred to CTLA-4+/- mice that had been crossed at least six times to the C57BL/6 strain to generate Tg+CTLA-4-/- mice. Tg+CTLA-4-/- were bred onto the C57BL/6 background for two to six generations.

For histological studies, tissues were fixed in 10% Formalin and embedded in paraffin. Sections were stained with hematoxylin and eosin using standard techniques.

In vitro stimulation and detection of CTLA-4 expression

Spleens were harvested and single-cell suspensions depleted of erythrocytes were prepared as described previously (36). Cells were grown in the presence of soluble 145-2C11 (0.1 µg/ml) and PV-1 (1 µg/ml) for the indicated times. Cell surface and intracellular CTLA-4 expression were detected by flow cytometry as described previously (42).

Cell surface staining

To assess the activation status of T cells, spleen and lymph node cells were stained with FITC-conjugated anti-CD8 and Cy-Chrome (CyC)5-conjugated anti-CD4 and a panel of PE-conjugated Abs including anti-CD25, anti-CD69, anti-CD44, anti-CD45RB, and anti-CD62L. To assess the activation status of B cells, spleen and lymph node cells were double-stained with CyC-conjugated anti-B220 and PE-conjugated anti-B7-1, anti-B7-2, or anti-class II IAb. All Abs were purchased from PharMingen (San Diego, CA). Stained cells were analyzed on a FACSort or a FACSCalibur (Becton Dickinson, Mountain View, CA).

Quantitation of serum Ig levels

Serum was collected from unimmunized 4-wk-old mice and analyzed by ELISA using commercial mAb pairs (PharMingen) according to the manufacturer’s instructions.

Keyhole limpet hemocyanin (KLH) injections

Mice were immunized in the hind footpads with 5 µg KLH (Calbiochem, San Diego, CA) precipitated in alum. Nine days after immunizations, draining popliteal lymph nodes were harvested and single-cell suspensions were prepared in DMEM (supplemented with 10% FCS, 2 mM glutamine, 50 mM HEPES (pH 7.5), 100 U/ml penicillin, 100 µg/ml streptomycin, and 50 µM 2-ME). For ex vivo stimulations, 5 x 105 cells were cultured in either media alone or with the addition of KLH at 100 µg/ml. Supernatants were harvested at 48 h and analyzed for IL-4 and IFN-{gamma} by ELISA using commercial mAb pairs (PharMingen) according to the manufacturer’s instructions.

Leishmania infections

Infections were performed as described previously (45). In brief, wild-type or transgenic mice were injected in both hind footpads with 1 x 106 (for one experiment) or 5 x 105 (for second experiment) metacyclic promastigotes of Leishmania major (WHOM/IR/-/173). Lesion size was determined by measuring footpads with a metric caliper. After 5–8 wk, draining popliteal lymph nodes were collected and stimulated in vitro with soluble Leishmania Ag and analyzed for cytokine production as described previously (45). Parasite burden was determined as described previously (45). The response of mice of mixed CD1/C57BL/6 genetic background to infection with Leishmania is comparable to that of wild-type C57BL/6 mice (S. L. Reiner, unpublished observations).


    Results
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Production of CTLA-4 transgenic+/CTLA-4-/- mice

T cell inhibition that is induced by CTLA-4 may be achieved through competition for CD28 ligands; in addition, the cytoplasmic domain of CTLA-4 may mediate CTLA-4 signal transduction. To determine the relative contributions of the different CTLA-4 domains to CTLA-4-inhibitory function in vivo, transgenic mice were generated that expressed either 1) full-length CTLA-4, 2) a CTLA-4 mutant in which the CTLA-4 cytoplasmic domain is replaced by random amino acids, or 3) a CTLA-4 mutant containing a valine substitution at Tyr201. The transgenes were expressed in mice under the regulation of the proximal Lck promoter and CD2 enhancer (Fig. 1GoA), and integration of the transgene was assessed by Southern blot analysis (data not shown). Constitutive expression of CTLA-4 transgenes was not observed to have gross physiological consequences in wild-type mice. Founders were then bred to homozygosity for the ctla-4 null mutation (19).



View larger version (42K):
[in this window]
[in a new window]
 
FIGURE 1. Production of CTLA-4 transgenic mice. A, Schematic illustration of the CTLA-4 transgene. The full-length (FL) CTLA-4 receptor, a CTLA-4 mutant in which the cytoplasmic domain has been replaced by random amino acid sequences ({Delta}Tail), or a CTLA-4 mutant in which valine has been substituted for Tyr201 (Y201V) were expressed as transgenes under the control of the Lck promoter and the CD2 enhancer. In this and subsequent figures, "{Delta}Tail" refers to "{Delta}CTLA-4 to 1." B, Surface and intracellular expression of CTLA-4 in T cells from transgenic mice. Lymph node cells from wild-type C57BL/6 or transgene+/CTLA-4-/- mice were stained with anti-CD3-CyC and anti-CTLA-4-PE and analyzed by flow cytometry. For intracellular staining, cells were permeabilized with saponin before staining. Shown are histograms of CTLA-4 expression on cells electronically gated on the CD3-positive population. CTLA-4 mean fluorescence is indicated in the upper right-hand corner. The filled histogram represents staining with PE-conjugated control hamster Ig.

 
Surface and intracellular CTLA-4 expression of the transgene-encoded proteins was analyzed by flow cytometry. As shown in Fig. 1GoB, CTLA-4 expression was not detected in CD3+ lymph node cells from wild-type C57BL/6 mice. In CTLA-4-/- mice expressing either the FL transgene or the {Delta}CTLA-4 tail transgene, low levels of CTLA-4 were detected on the cell surface of CD3+ lymph node cells, as indicated by a consistently higher mean fluorescence intensity compared with that obtained for cells from wild-type mice. In contrast, in mice expressing the Y201V mutant, higher levels of CTLA-4 were detected on the cell surface. Expression of all three transgenes was readily detected intracellularly (Fig. 1GoB, bottom panels). The increased cell surface expression of the Y201V mutant is consistent with the role of Y201 in mediating CTLA-4 endocytosis. The {Delta}CTLA-4 tail mutant, which also lacks Y201, did not exhibit a similar increase in expression. This suggests that other residues within the CTLA-4 cytoplasmic domain are important for normal trafficking of CTLA-4 to the plasma membrane and/or its stable accumulation on the cell surface.

Expression of transgene-encoded CTLA-4 upon T cell activation

In wild-type animals, CTLA-4 is not expressed on naive T cells but is induced upon T cell activation. To examine the effect of T cell stimulation on transgene-encoded CTLA-4 surface expression, splenocytes were stimulated with soluble anti-CD3 plus anti-CD28 and examined by flow cytometry for CTLA-4 expression on both CD4+ and CD8+ T cell subsets. CD4+ and CD8+ splenocytes from FL/CTLA-4-/- mice exhibited low but constitutive CTLA-4 surface expression that did not change with T cell activation (Fig. 2GoA and data not shown). CD4+ and CD8+ splenocytes from {Delta}CTLA-4 tail/CTLA-4-/- and Y201V/CTLA-4-/- mice showed increased expression of surface CTLA-4 with stimulation, displaying similar kinetics compared with wild-type cells (Fig. 2Go, B and C). Surface expression levels on cells isolated from {Delta}CTLA-4 tail/CTLA-4-/- mice reached similar levels as detected on wild-type cells (Fig. 2GoB). Surface expression levels on cells isolated from Y201V/CTLA-4-/- mice reached 10 times higher geometric mean fluorescence intensity compared with wild-type cells (Fig. 2GoC).



View larger version (43K):
[in this window]
[in a new window]
 
FIGURE 2. Kinetics of cell surface and total cellular expression of transgene-encoded CTLA-4. Spleen cells from wild-type, FL/CTLA-4-/-, {Delta}CTLA-4 tail/CTLA-4-/-, and Y201V/CTLA-4-/- mice were stimulated with soluble Abs to CD3 and CD28 as described in Materials and Methods. Cells were harvested at the indicated time points and surface stained for CD4 and CTLA-4 (A–C) or surface stained for CD4, fixed, permeabilized, and then stained for intracellular CTLA-4 (D). Results represent the geometric mean fluorescence of CD4+ cells obtained with the anti-CTLA-4 mAb minus that obtained with control hamster Ig and are representative of three independent experiments. Surface CTLA-4 expression on FL/CTLA-4-/- (A), {Delta}CTLA-4 tail/CTLA-4-/- (B), and Y201V/CTLA-4-/- (C) cells compared with wild-type cells. D, Total cellular expression of CTLA-4 on FL/CTLA-4-/-, {Delta}CTLA-4 tail/CTLA-4-/-, and Y201V/CTLA-4-/- cells compared with wild-type C57BL/6 cells.

 
Total cellular expression of CTLA-4 on CD4+ cells from FL/CTLA-4-/-, {Delta}CTLA-4 tail/CTLA-4-/-, and Y201V/CTLA-4-/- mice showed similar kinetics of expression compared with wild-type cells (Fig. 2GoD). Cells from {Delta}CTLA-4 tail/CTLA-4-/- and Y201V/CTLA-4-/- mice obtained higher levels and cells from FL/CTLA-4-/- mice obtained lower levels of peak expression compared with wild-type cells. Similar to what was seen in wild-type cells, expression of CTLA-4 on CD8+ cells, both surface and total, from each of the transgenic animals mirrored that detected on CD4+ cells but with slightly higher levels of expression (data not shown).

Effect on lethality

CTLA-4 deficiency results in a lethal phenotype with death occurring at ~3–4 wk of age. CTLA-4-/- animals bearing the FL transgene or the Y201V transgene were completely rescued from early lethality. FL/CTLA-4-/- and Y201V/CTLA-4-/- mice lived well into adulthood and reproduced normally. {Delta}CTLA-4 tail/CTLA-4-/- mice also lived into adulthood and reproduced normally. A second founder expressing lower levels of the {Delta}CTLA-4 tail transgene also showed prolonged survival, although most of these animals ultimately succumbed to lymphoproliferative disease. Thus, the ability of the {Delta}CTLA-4 tail transgene to rescue the lethality of the disease correlated with the level of the {Delta}CTLA-4 tail receptor detected on the surface of CD4+ T cells. Experiments shown are from animals derived from the founder that expressed higher levels of the {Delta}CTLA-4 tail transgene.

Effect on homeostasis and accumulation of activated T cells

In addition to early death, CTLA-4-deficient mice display splenomegaly and lymphadenopathy with the number of lymphocytes in the spleen and lymph nodes reaching 5- to 10-fold higher numbers compared with wild-type animals (19, 20). The presence of the FL or Y201V transgene corrected this defect (Fig. 3Go). In contrast, lymph nodes (but not spleens) from {Delta}CTLA-4 tail/CTLA-4-/- animals showed increasing numbers of cells with age, achieving 10-fold higher numbers compared with age-matched wild-type controls.



View larger version (19K):
[in this window]
[in a new window]
 
FIGURE 3. {Delta}CTLA-4 tail/CTLA-4-/- mice accumulated increased numbers of lymph node cells with age. Lymph nodes were isolated from wild-type, CTLA-4-/-, FL/CTLA-4-/-, {Delta}CTLA-4 tail/CTLA-4-/-, and Y201V/CTLA-4-/- mice at the indicated time points and cell number per animal was determined.

 
To examine whether these animals, like CTLA-4-deficient mice, also accumulated activated T cells, lymph node and spleen cells were stained for CD4 and CD8 and various T cell activation markers. Young FL/CTLA-4-/-, {Delta}CTLA-4 tail/CTLA-4-/-, and Y201V/CTLA-4-/- mice maintained a naive T cell phenotype and displayed normal percentages of CD4+, CD8+, and B220+ cells (data not shown). At 2 mo of age, FL/CTLA-4-/- and Y201V/CTLA-4-/- mice still maintained a naive phenotype, as increased expression of the activation markers CD25 and CD69 was not detected in T cells from these mice. In contrast, 2-mo-old {Delta}CTLA-4 tail/CTLA-4-/- mice displayed an increase in both the percentage and absolute numbers of CD4+ lymph node cells expressing increased levels of the activation markers CD25, CD69, or CD44 and decreased levels of CD45RB and CD62L (Fig. 4Go and data not shown). The percentage of CD8+ lymph node cells from 2-mo-old {Delta}CTLA-4 tail/CTLA-4-/- mice displaying activation markers was also increased (data not shown).



View larger version (35K):
[in this window]
[in a new window]
 
FIGURE 4. Two-month-old {Delta}CTLA-4 tail/CTLA-4-/- mice showed increased percentages of activated CD4+ T cells. Lymph node cells from 2-mo-old wild-type, FL/CTLA-4-/-, {Delta}CTLA-4 tail/CTLA-4-/-, and Y201V/CTLA-4-/- mice were double stained for CD4 and either the activation marker CD25 or CD69. For comparison, expression of activation markers on CD4+ lymph node cells from a 4-wk-old CTLA-4-/- mouse is also shown. The percentage given is the percentage of CD4+ cells staining positively for the indicated marker.

 
Despite the presence of large numbers of activated T cells in 2-mo-old {Delta}CTLA-4 tail/CTLA-4-/- mice, there was no evidence of mononuclear infiltrates in any of the organs analyzed (Fig. 5Go). FL/CTLA-4-/- and Y201V/CTLA-4-/- mice also showed no evidence of lymphocytic infiltration into any of the organs analyzed (data not shown).



View larger version (166K):
[in this window]
[in a new window]
 
FIGURE 5. Histological sections of heart and liver from 4-wk-old wild-type (C57BL/6) mice, 4-wk-old CTLA-4-/- mice, or 2-mo-old {Delta}CTLA-4 tail/CTLA-4-/- mice. Sections were stained with hematoxylin and eosin and visualized by light microscopy using a x40 oil immersion objective.

 
{Delta}CTLA-4 tail/CTLA-4-/- mice display a Th2-biased phenotype

In addition to accumulation of activated T cells, {Delta}CTLA-4 tail/CTLA-4-/- mice also showed in vivo activation of B cells as determined by the up-regulation of MHC class II and B7-2 molecules (data not shown). FL/CTLA-4-/- and Y201V/CTLA-4-/- mice exhibited normal percentages of activated B cells. To quantitate basal Ig isotype levels, we analyzed sera from unimmunized wild-type mice, CTLA-4-/- mice, and the three different Tg+/CTLA-4-/- lines by ELISA. Compared with wild-type mice, CTLA-4-/- animals showed increased levels of IgG1, IgG2a, and IgE (data not shown and Ref. 19), whereas there was no difference in the levels of these Igs between wild-type and FL/CTLA-4-/- or Y201V/CTLA-4-/- mice (Fig. 6Go). In contrast, {Delta}CTLA-4 tail/CTLA-4-/- mice had significantly higher levels of only the IL-4-dependent Igs IgG1 and IgE and had lower levels of the IFN-{gamma}-dependent Ig IgG2a compared with wild-type mice (Fig. 6Go), indicative of a Th2-biased phenotype.



View larger version (17K):
[in this window]
[in a new window]
 
FIGURE 6. {Delta}CTLA-4 tail/CTLA-4-/- mice displayed a Th2 phenotype. Sera obtained from 4-wk-old unimmunized wild-type, FL/CTLA-4-/-, {Delta}CTLA-4 tail/CTLA-4-/-, and Y201V/CTLA-4-/- mice were analyzed by ELISA for IgG1, IgG2a, and IgE. Four individual animals were analyzed for each group.

 
To determine whether the Th2 skewing observed in {Delta}CTLA-4 tail/CTLA-4-/- mice reflected a feature of an in vivo Ag-specific immune response, we immunized mice with KLH precipitated in alum. Nine days later, draining lymph node cells were restimulated with KLH in vitro and the cytokine profile was determined (Fig. 7Go). Cultures from FL/CTLA-4-/- mice produced relatively equivalent levels of IL-4 and IFN-{gamma} compared with cultures from wild-type mice. Cultures from Y201V/CTLA-4-/- mice were variable, sometimes displaying similar levels of IL-4 and IFN-{gamma} compared with wild-type cultures and sometimes showing higher levels of both IL-4 and IFN-{gamma}. In contrast, cultures from {Delta}CTLA-4 tail/CTLA-4-/- mice consistently produced greatly elevated levels of IL-4 compared with wild-type cultures and low to undetectable levels of IFN-{gamma}, indicative of an enhanced Th2 response. The differences in cytokine production were not due to differences in proliferative capacity because lymph node cells isolated from transgenic and wild-type mice rechallenged with graded doses of KLH or a control Ag demonstrated similar proliferative responses (data not shown).



View larger version (19K):
[in this window]
[in a new window]
 
FIGURE 7. Lymph node cells from {Delta}CTLA-4 tail/CTLA-4-/- mice produce an enhanced Th2 response upon stimulation with KLH. Wild-type, FL/CTLA-4-/-, {Delta}CTLA-4 tail/CTLA-4-/-, and Y201V/CTLA-4-/- mice were immunized with KLH precipitated in alum. Nine days later, draining lymph node cells were stimulated with KLH for 2 days and supernatants were analyzed for levels of IFN-{gamma} ({square}) and IL-4 ({blacksquare}) by ELISA. The results shown are the mean of triplicate wells from individual mice and are representative of five mice from three independent experiments.

 
{Delta}CTLA-4 tail/CTLA-4-/- mice are susceptible to infection with L. major

Th cells from {Delta}CTLA-4 tail/CTLA-4-/- mice appear to skew toward a Th2 pathway as evidenced in elevated production of the Th2 cytokine IL-4 by effector cells ex vivo and increased production of the IL-4-dependent Igs IgG1 and IgE. To determine whether this bias in differentiation resulted in physiological consequences in vivo, mice were injected in the hind footpads with the intracellular pathogen L. major. Control of this disease is dependent on the successful development of Th1 cells and their production of IFN-{gamma}, which is required to activate macrophage-mediated clearance of the parasite (46). Strains that are genetically predisposed to produce a Th1 response, such as the C57BL/6 and CD1 strains, are able to control the disease. IL-4 production by Th2 cells negatively regulates macrophage-activated clearing and, therefore, strains such as BALB/c that are genetically predisposed to develop a Th2 response are susceptible to the disease.

The course of infection was monitored by measuring the size of the local lesions (Fig. 8GoA). Wild-type C57BL/6 mice were capable of controlling the infection, with the initial slight swelling of the injected footpads being followed by resolution of the lesions. BALB/c mice were unable to control the infection and developed progressive enlargement of their footpads. FL/CTLA-4-/- and Y201V/CTLA-4-/- mice were capable of controlling the infection, showing resolution of their lesions. In contrast, {Delta}CTLA-4 tail/CTLA-4-/- mice were unable to control the infection and demonstrated progressive enlargement of their footpad lesions. Parasite cultures from the feet and spleens of the infected mice confirmed that FL/CTLA-4-/- and Y201V/CTLA-4-/- mice had resolved the infection, whereas {Delta}CTLA-4 tail/CTLA-4-/- mice had not (data not shown).



View larger version (31K):
[in this window]
[in a new window]
 
FIGURE 8. {Delta}CTLA-4 tail/CTLA-4-/- mice are susceptible whereas FL/CTLA-4-/- and Y201V/CTLA-4-/- mice are resistant to infection with L. major. A, BALB/c, C57BL/6, FL/CTLA-4-/-, {Delta}CTLA-4 tail/CTLA-4-/-, and Y201V/CTLA-4-/- mice were infected in each hind footpad with L. major as described in Materials and Methods. Disease progression was determined by measuring footpad thickness with a metric caliper. The results shown are the mean footpad measurements of groups of two animals each and are representative of eight animals from two independent experiments. B, Susceptibility to L. major infection correlates with increased production of IL-4. Draining popliteal lymph node cells from infected animals were collected and cultured with soluble parasite Ag in vitro. After 48 h, supernatants were analyzed by ELISA for IFN-{gamma} ({square}) and IL-4 ({blacksquare}) levels. The results shown are the mean of triplicate wells from individual mice and are representative of five mice from two independent experiments.

 
Draining lymph node cells from infected animals were restimulated in vitro with soluble Leishmania Ag and cytokine profiles were determined (Fig. 8GoB). Resistant animals, including FL/CTLA-4-/- and Y201V/CTLA-4-/- mice, produced undetectable levels of IL-4 and produced high amounts of IFN-{gamma}. In contrast, susceptible mice, including {Delta}CTLA-4 tail/CTLA-4-/- mice, produced high levels of IL-4. Addition of an anti-MHC class II Ab resulted in undetectable levels of cytokines in all cultures, demonstrating that class II-restricted helper T cells were mediating these effects (data not shown). These data confirmed that increased susceptibility of {Delta}CTLA-4 tail/CTLA-4-/- mice to L. major infection correlates with increased production of IL-4.


    Discussion
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
CTLA-4-/- mice have proven to be a valuable system for elucidating the in vivo functions and interactions of molecules involved in the CD28/CTLA-4:B7-1/B7-2 pathway. To identify critical regions involved in the regulation of the immune inhibitory function of CTLA-4, we have introduced various CTLA-4 transgenes into mice deficient for endogenous CTLA-4. A wild-type form of CTLA-4 introduced into CTLA-4-/- mice rescues the null phenotype. A mutated form of CTLA-4 lacking the cytoplasmic domain is able to provide for a partial rescue. Mice that lack the CTLA-4 cytoplasmic domain are long-lived but show progressive lymphadenopathy and accumulate activated T cells with age. Lymphocytic infiltration and tissue destruction are absent in this line, providing an explanation of why these animals do not succumb to an early death. These results demonstrate that the presence of the extracellular and transmembrane portions of CTLA-4 is able to provide an inhibitory effect sufficient to control autoimmunity but insufficient to control homeostasis. This effect appears to require a critical level of cell surface expression since a second founder that expressed lower levels of the {Delta}CTLA-4 tail transgene still developed autoimmunity but with delayed onset. However, even when the mutant receptor lacking the CTLA-4 cytoplasmic domain is expressed at levels comparable to endogenous CTLA-4 on wild-type cells, the rescue of the CTLA-4-/- phenotype is incomplete. These data suggest that CTLA-4 ligand binding alone is not sufficient to account for the ability of CTLA-4 to suppress ongoing T cell activation and accumulation.

The highest levels of constitutive and inducible CTLA-4 expression were observed with the CTLA-4 Y201V animals. These animals also displayed a complete rescue of the CTLA-4-/- phenotype, suggesting that Y201 may not be absolutely required for CTLA-4 function. However, since mutation of Y201 results in greatly increased levels of CTLA-4 on the cell surface, it is possible that this increase in CTLA-4 surface expression can compensate for any defect due to a lack of Y201. CTLA-4 has been proposed to suppress the activation of resting cells, therefore inducing anergy or increasing the threshold of T cell activation. Both FL CTLA-4 and Y201V CTLA-4 are expressed in freshly isolated cells at levels that are reproducibly higher than wild-type cells; nevertheless, these animals are able to mount a curative immune response to leishmaniasis. Thus, constitutive CTLA-4 expression does not prevent activation of naive T cells to pathogens even when expressed at supraphysiological levels.

We have found that the CTLA-4 cytoplasmic domain plays an important role in the regulation of T cell activation and Th cell differentiation. Although an initial characterization of the CTLA-4-/- mice did not find a skewing toward either a Th1 or Th2 phenotype (20), recent in vitro studies have suggested that a lack of CTLA-4 function may predispose activated T cells toward Th2 development (47, 48). The studies presented here provide an in vivo demonstration of the critical role of CTLA-4 in regulating the Th1/Th2 balance and show that the Th2 skewing in these mice is physiologically relevant. Furthermore, our data suggest that this skewing alone is insufficient to result in autoimmune organ dysfunction and that additional mechanisms must exist for manifestation of the full CTLA-4-deficient phenotype. The molecular basis for the regulation of Th differentiation by CTLA-4 is not known, but may be due to the induction of specific transcription factors that regulate Th cell development upon CTLA-4 activation (49) and/or an effect of CTLA-4 on cell cycle progression and cell division (50).

In summary, these studies suggest that the inhibitory effect of CTLA-4 is mediated in part by competition for B7 ligands but that the cytoplasm domain of CTLA-4 is required for full inhibitory function. These data also provide in vivo evidence that CTLA-4 plays a role in regulating the Th1/Th2 balance. The {Delta}CTLA-4 tail/CTLA-4-/- animals displayed evidence of a progressive systemic involvement of Th2 cells and responded to in vivo challenge with a Th2-biased response. Since this phenotype is corrected by the FL and Y201V transgenes, the data suggest that the CTLA-4 cytoplasmic domain is contributing to the regulation of Th1/Th2 balance. This could occur through its ability to initiate signal transduction or as a result of its ability to localize CTLA-4 to specific sites during T cell activation. These data support that residues in addition to Tyr201 play a critical role in regulating the activity of CTLA-4.


    Acknowledgments
 
We thank Mandel Davis for technical assistance and Drs. R. Arch and M.-L. Alegre for helpful discussions and critiques of this manuscript.


    Footnotes
 
1 This work was supported by National Institutes of Health Grants P01 DK49799 (to C.B.T.), AI 42370 (to S.L.R.), and K08 CA78591 (to E.C.). Back

2 E.L.M. and E.C. contributed equally to this work. Back

3 Dr. Ellen Chuang at her current address: Department of Medicine, Division of Hematology/Oncology, Weill Medical College of Cornell University, 525 East 68th Street, New York, NY 10021. Back

4 Address correspondence and reprint requests to Dr. Emma L. Masteller at her current address: Ben May Institute for Cancer Research, 5841 South Maryland Avenue, MC 1089, Chicago, IL 60637. Back

5 Abbreviations used in this paper: CyC, Cy-Chrome; KLH, keyhole limpet hemocyanin. Back

Received for publication November 2, 1999. Accepted for publication March 3, 2000.


    References
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 

  1. Thompson, C. B., J. P. Allison. 1997. The emerging role of CTLA-4 as an immune attenuator. Immunity 7:445.[Medline]
  2. Chambers, C. A., J. P. Allison. 1999. Costimulatory regulation of T cell function. Curr. Opin. Cell Biol. 11:203.[Medline]
  3. Oosterwegel, M. A., R. J. Greenwald, D. A. Mandelbrot, R. B. Lorsbach, A. H. Sharpe. 1999. CTLA-4 and T cell activation. Curr. Opin. Immunol. 11:294.[Medline]
  4. Leach, D. R., M. F. Krummel, J. P. Allison. 1996. Enhancement of antitumor immunity by CTLA-4 blockade. Science 271:1734.[Abstract]
  5. Kwon, E. D., A. A. Hurwitz, B. A. Foster, C. Madias, A. L. Feldhaus, N. M. Greenberg, M. B. Burg, J. P. Allison. 1997. Manipulation of T cell costimulatory and inhibitory signals for immunotherapy of prostate cancer. Proc. Natl. Acad. Sci. USA 94:8099.[Abstract/Free Full Text]
  6. Yang, Y. F., J. P. Zou, J. Mu, R. Wijesuriya, S. Ono, T. Walunas, J. Bluestone, H. Fujiwara, T. Hamaoka. 1997. Enhanced induction of antitumor T-cell responses by cytotoxic T lymphocyte-associated molecule-4 blockade: the effect is manifested only at the restricted tumor-bearing stages. Cancer Res. 57:4036.[Abstract/Free Full Text]
  7. Hurwitz, A. A., T. F. Yu, D. R. Leach, J. P. Allison. 1998. CTLA-4 blockade synergizes with tumor-derived granulocyte-macrophage colony-stimulating factor for treatment of an experimental mammary carcinoma. Proc. Natl. Acad. Sci. USA 95:10067.[Abstract/Free Full Text]
  8. McCoy, K., M. Camberis, G. L. Gros. 1997. Protective immunity to nematode infection is induced by CTLA-4 blockade. J. Exp. Med. 186:183.[Abstract/Free Full Text]
  9. Murphy, M. L., S. E. Cotterell, P. M. Gorak, C. R. Engwerda, P. M. Kaye. 1998. Blockade of CTLA-4 enhances host resistance to the intracellular pathogen, Leishmania donovani. J. Immunol. 161:4153.[Abstract/Free Full Text]
  10. Saha, B., S. Chattopadhyay, R. Germond, D. M. Harlan, P. J. Perrin. 1998. CTLA4 (CD152) modulates the Th subset response and alters the course of experimental Leishmania major infection. Eur. J. Immunol. 28:4213.[Medline]
  11. van Elsas, A., A. A. Hurwitz, J. P. Allison. 1999. Combination immunotherapy of B16 melanoma using anti-cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) and granulocyte/macrophage colony-stimulating factor (GM-CSF)-producing vaccines induces rejection of subcutaneous and metastatic tumors accompanied by autoimmune depigmentation. J. Exp. Med. 190:355.[Abstract/Free Full Text]
  12. Karandikar, N. J., C. L. Vanderlugt, T. L. Walunas, S. D. Miller, J. A. Bluestone. 1996. CTLA-4: a negative regulator of autoimmune disease. J. Exp. Med. 184:783.[Abstract/Free Full Text]
  13. Perrin, P. J., J. H. Maldonado, T. A. Davis, C. H. June, M. K. Racke. 1996. CTLA-4 blockade enhances clinical disease and cytokine production during experimental allergic encephalomyelitis. J. Immunol. 157:1333.[Abstract]
  14. Luhder, F., P. Hoglund, J. P. Allison, C. Benoist, D. Mathis. 1998. Cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) regulates the unfolding of autoimmune diabetes. J. Exp. Med. 187:427.[Abstract/Free Full Text]
  15. Lin, H., J. C. Rathmell, G. S. Gray, C. B. Thompson, J. M. Leiden, M. L. Alegre. 1998. Cytotoxic T lymphocyte antigen 4 (CTLA4) blockade accelerates the acute rejection of cardiac allografts in CD28-deficient mice: CTLA4 can function independently of CD28. J. Exp. Med. 188:199.[Abstract/Free Full Text]
  16. Saito, K., J. Sakurai, J. Ohata, T. Kohsaka, H. Hashimoto, K. Okumura, R. Abe, M. Azuma. 1998. Involvement of CD40 ligand-CD40 and CTLA4–B7 pathways in murine acute graft-versus-host disease induced by allogeneic T cells lacking CD28. J. Immunol. 160:4225.[Abstract/Free Full Text]
  17. Perez, V. L., L. Van Parijs, A. Biuckians, X. X. Zheng, T. B. Strom, A. K. Abbas. 1997. Induction of peripheral T cell tolerance in vivo requires CTLA-4 engagement. Immunity 6:411.[Medline]
  18. Walunas, T. L., J. A. Bluestone. 1998. CTLA-4 regulates tolerance induction and T cell differentiation in vivo. J. Immunol. 160:3855.[Abstract/Free Full Text]
  19. Waterhouse, P., J. M. Penninger, E. Timms, A. Wakeham, A. Shahinian, K. P. Lee, C. B. Thompson, H. Griesser, T. W. Mak. 1995. Lymphoproliferative disorders with early lethality in mice deficient in Ctla-4. Science 270:985.[Abstract/Free Full Text]
  20. Tivol, E. A., F. Borriello, A. N. Schweitzer, W. P. Lynch, J. A. Bluestone, A. H. Sharpe. 1995. Loss of CTLA-4 leads to massive lymphoproliferation and fatal multiorgan tissue destruction, revealing a critical negative regulatory role of CTLA-4. Immunity 3:541.[Medline]
  21. Chambers, C. A., D. Cado, T. Truong, J. P. Allison. 1997. Thymocyte development is normal in CTLA-4-deficient mice. Proc. Natl. Acad. Sci. USA 94:9296.[Abstract/Free Full Text]
  22. Waterhouse, P., M. F. Bachmann, J. M. Penninger, P. S. Ohashi, T. W. Mak. 1997. Normal thymic selection, normal viability and decreased lymphoproliferation in T cell receptor-transgenic CTLA-4-deficient mice. Eur. J. Immunol. 27:1887.[Medline]
  23. Chambers, C. A., T. J. Sullivan, J. P. Allison. 1997. Lymphoproliferation in CTLA-4-deficient mice is mediated by costimulation-dependent activation of CD4+ T cells. Immunity 7:885.[Medline]
  24. Tivol, E. A., S. D. Boyd, S. McKeon, F. Borriello, P. Nickerson, T. B. Strom, A. H. Sharpe. 1997. CTLA4Ig prevents lymphoproliferation and fatal multiorgan tissue destruction in CTLA-4-deficient mice. J. Immunol. 158:5091.[Abstract]
  25. Mandelbrot, D. A., A. J. McAdam, A. H. Sharpe. 1999. B7-1 or B7-2 is required to produce the lymphoproliferative phenotype in mice lacking cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). J. Exp. Med. 189:435.[Abstract/Free Full Text]
  26. Bachmann, M. F., G. Kohler, B. Ecabert, T. W. Mak, M. Kopf. 1999. Cutting edge: lymphoproliferative disease in the absence of CTLA-4 is not T cell autonomous. J. Immunol. 163:1128.[Abstract/Free Full Text]
  27. Linsley, P. S., W. Brady, M. Urnes, L. S. Grosmaire, N. K. Damle, J. A. Ledbetter. 1991. CTLA-4 is a second receptor for the B cell activation antigen B7. J. Exp. Med. 174:561.[Abstract/Free Full Text]
  28. Linsley, P. S., J. L. Greene, W. Brady, J. Bajorath, J. A. Ledbetter, R. Peach. 1994. Human B7-1 (CD80) and B7-2 (CD86) bind with similar avidities but distinct kinetics to CD28 and CTLA-4 receptors. Immunity 1:793.[Medline]
  29. van der Merwe, P. A., D. L. Bodian, S. Daenke, P. Linsley, S. J. Davis. 1997. CD80 (B7-1) binds both CD28 and CTLA-4 with a low affinity and very fast kinetics. J. Exp. Med. 185:393.[Abstract/Free Full Text]
  30. Schneider, H., K. V. Prasad, S. E. Shoelson, C. E. Rudd. 1995. CTLA-4 binding to the lipid kinase phosphatidylinositol 3-kinase in T cells. J. Exp. Med. 181:351.[Abstract/Free Full Text]
  31. Calvo, C. R., D. Amsen, A. M. Kruisbeek. 1997. Cytotoxic T lymphocyte antigen 4 (CTLA-4) interferes with extracellular signal-regulated kinase (ERK) and Jun NH2-terminal kinase (JNK) activation, but does not affect phosphorylation of T cell receptor {zeta} and ZAP70. J. Exp. Med. 186:1645.[Abstract/Free Full Text]
  32. Lee, K. M., E. Chuang, M. Griffin, R. Khattri, D. K. Hong, W. Zhang, D. Straus, L. E. Samelson, C. B. Thompson, J. A. Bluestone. 1998. Molecular basis of T cell inactivation by CTLA-4. Science 282:2263.[Abstract/Free Full Text]
  33. Marengere, L. E., P. Waterhouse, G. S. Duncan, H. W. Mittrucker, G. S. Feng, T. W. Mak. 1996. Regulation of T cell receptor signaling by tyrosine phosphatase SYP association with CTLA-4. Science 272:1170.[Abstract]
  34. Leung, H. T., J. Bradshaw, J. S. Cleaveland, P. S. Linsley. 1995. Cytotoxic T lymphocyte-associated molecule-4, a high-avidity receptor for CD80 and CD86, contains an intracellular localization motif in its cytoplasmic tail. J. Biol. Chem. 270:25107.[Abstract/Free Full Text]
  35. Linsley, P. S., J. Bradshaw, J. Greene, R. Peach, K. L. Bennett, R. S. Mittler. 1996. Intracellular trafficking of CTLA-4 and focal localization towards sites of TCR engagement. Immunity 4:535.[Medline]
  36. Alegre, M. L., P. J. Noel, B. J. Eisfelder, E. Chuang, M. R. Clark, S. L. Reiner, C. B. Thompson. 1996. Regulation of surface and intracellular expression of CTLA4 on mouse T cells. J. Immunol. 157:4762.[Abstract]
  37. Schneider, H., M. Martin, F. A. Agarraberes, L. Yin, I. Rapoport, T. Kirchhausen, C. E. Rudd. 1999. Cytolytic T lymphocyte-associated antigen-4 and the TCR{zeta}/CD3 complex, but not CD28, interact with clathrin adaptor complexes AP-1 and AP-2. J. Immunol. 163:1868.[Abstract/Free Full Text]
  38. Chuang, E., M. L. Alegre, C. S. Duckett, P. J. Noel, M. G. Vander Heiden, C. B. Thompson. 1997. Interaction of CTLA-4 with the clathrin-associated protein AP50 results in ligand-independent endocytosis that limits cell surface expression. J. Immunol. 159:144.[Abstract]
  39. Shiratori, T., S. Miyatake, H. Ohno, C. Nakaseko, K. Isono, J. S. Bonifacino, T. Saito. 1997. Tyrosine phosphorylation controls internalization of CTLA-4 by regulating its interaction with clathrin-associated adaptor complex AP- 2. Immunity 6:583.[Medline]
  40. Zhang, Y., J. P. Allison. 1997. Interaction of CTLA-4 with AP50, a clathrin-coated pit adaptor protein. Proc. Natl. Acad. Sci. USA 94:9273.[Abstract/Free Full Text]
  41. Bradshaw, J. D., P. Lu, G. Leytze, J. Rodgers, G. L. Schieven, K. L. Bennett, P. S. Linsley, S. E. Kurtz. 1997. Interaction of the cytoplasmic tail of CTLA-4 (CD152) with a clathrin-associated protein is negatively regulated by tyrosine phosphorylation. Biochemistry 36:15975.[Medline]
  42. Chuang, E., K. M. Lee, M. D. Robbins, J. M. Duerr, M. L. Alegre, J. E. Hambor, M. J. Neveu, J. A. Bluestone, C. B. Thompson. 1999. Regulation of cytotoxic T lymphocyte-associated molecule-4 by Src kinases. J. Immunol. 162:1270.[Abstract/Free Full Text]
  43. Allen, J. M., K. A. Forbush, R. M. Perlmutter. 1992. Functional dissection of the lck proximal promoter. Mol. Cell. Biol. 12:2758.[Abstract/Free Full Text]
  44. Lake, R. A., D. Wotton, M. J. Owen. 1990. A 3' transcriptional enhancer regulates tissue-specific expression of the human CD2 gene. EMBO J. 9:3129.[Medline]
  45. Brown, D. R., K. Swier, N. H. Moskowitz, M. F. Naujokas, R. M. Locksley, S. L. Reiner. 1997. T helper subset differentiation in the absence of invariant chain. J. Exp. Med. 185:31.[Abstract/Free Full Text]
  46. Reiner, S. L., R. M. Locksley. 1995. The regulation of immunity to Leishmania major. Annu. Rev. Immunol. 13:151.[Medline]
  47. Khattri, R., J. A. Auger, M. D. Griffin, A. H. Sharpe, J. A. Bluestone. 1999. Lymphoproliferative disorder in CTLA-4 knockout mice is characterized by CD28-regulated activation of Th2 responses. J. Immunol. 162:5784.[Abstract/Free Full Text]
  48. Oosterwegel, M. A., D. A. Mandelbrot, S. D. Boyd, R. B. Lorsbach, D. Y. Jarrett, A. K. Abbas, A. H. Sharpe. 1999. The role of CTLA-4 in regulating Th2 differentiation. J. Immunol. 163:2634.[Abstract/Free Full Text]
  49. O’Garra, A.. 1998. Cytokines induce the development of functionally heterogeneous T helper cell subsets. Immunity 8:275.[Medline]
  50. Reiner, S. L., R. A. Seder. 1999. Dealing from the evolutionary pawn shop: how lymphocytes make decisions. Immunity 11:1.[Medline]



This article has been cited by other articles:


Home page
J. Immunol.Home page
M. Araki, D. Chung, S. Liu, D. B. Rainbow, G. Chamberlain, V. Garner, K. M. D. Hunter, L. Vijayakrishnan, L. B. Peterson, M. Oukka, et al.
Genetic Evidence That the Differential Expression of the Ligand-Independent Isoform of CTLA-4 Is the Molecular Basis of the Idd5.1 Type 1 Diabetes Region in Nonobese Diabetic Mice
J. Immunol., October 15, 2009; 183(8): 5146 - 5157.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
J.-M. Choi, S.-H. Kim, J.-H. Shin, T. Gibson, B.-S. Yoon, D.-H. Lee, S.-K. Lee, A. L. M. Bothwell, J.-S. Lim, and S.-K. Lee
Transduction of the cytoplasmic domain of CTLA-4 inhibits TcR-specific activation signals and prevents collagen-induced arthritis
PNAS, December 16, 2008; 105(50): 19875 - 19880.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
M. D. Taylor, A. Harris, S. A. Babayan, O. Bain, A. Culshaw, J. E. Allen, and R. M. Maizels
CTLA-4 and CD4+CD25+ Regulatory T Cells Inhibit Protective Immunity to Filarial Parasites In Vivo
J. Immunol., October 1, 2007; 179(7): 4626 - 4634.
[Abstract] [Full Text] [PDF]


Home page
BloodHome page
A. Hryniewicz, A. Boasso, Y. Edghill-Smith, M. Vaccari, D. Fuchs, D. Venzon, J. Nacsa, M. R. Betts, W.-P. Tsai, J.-M. Heraud, et al.
CTLA-4 blockade decreases TGF-beta, IDO, and viral RNA expression in tissues of SIVmac251-infected macaques
Blood, December 1, 2006; 108(12): 3834 - 3842.
[Abstract] [Full Text] [PDF]


Home page
ScienceHome page
H. Schneider, J. Downey, A. Smith, B. H. Zinselmeyer, C. Rush, J. M. Brewer, B. Wei, N. Hogg, P. Garside, and C. E. Rudd
Reversal of the TCR Stop Signal by CTLA-4
Science, September 29, 2006; 313(5795): 1972 - 1975.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
J. J. Engelhardt, T. J. Sullivan, and J. P. Allison
CTLA-4 Overexpression Inhibits T Cell Responses through a CD28-B7-Dependent Mechanism
J. Immunol., July 15, 2006; 177(2): 1052 - 1061.
[Abstract] [Full Text] [PDF]


Home page
GutHome page
L M Amezcua-Guerra, B Hernandez-Martinez, C Pineda, and R Bojalil
Ulcerative colitis during CTLA-4Ig therapy in a patient with rheumatoid arthritis
Gut, July 1, 2006; 55(7): 1059 - 1060.
[Full Text] [PDF]


Home page
J. Immunol.Home page
S. G. Zheng, J. H. Wang, W. Stohl, K. S. Kim, J. D. Gray, and D. A. Horwitz
TGF-beta Requires CTLA-4 Early after T Cell Activation to Induce FoxP3 and Generate Adaptive CD4+CD25+ Regulatory Cells
J. Immunol., March 15, 2006; 176(6): 3321 - 3329.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
D. Homann, W. Dummer, T. Wolfe, E. Rodrigo, A. N. Theofilopoulos, M. B. A. Oldstone, and M. G. von Herrath
Lack of Intrinsic CTLA-4 Expression Has Minimal Effect on Regulation of Antiviral T-Cell Immunity
J. Virol., January 1, 2006; 80(1): 270 - 280.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
R. J. Salmond, G. Huyer, A. Kotsoni, L. Clements, and D. R. Alexander
The src Homology 2 Domain-Containing Tyrosine Phosphatase 2 Regulates Primary T-Dependent Immune Responses and Th Cell Differentiation
J. Immunol., November 15, 2005; 175(10): 6498 - 6508.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
R. V. Parry, J. M. Chemnitz, K. A. Frauwirth, A. R. Lanfranco, I. Braunstein, S. V. Kobayashi, P. S. Linsley, C. B. Thompson, and J. L. Riley
CTLA-4 and PD-1 Receptors Inhibit T-Cell Activation by Distinct Mechanisms
Mol. Cell. Biol., November 1, 2005; 25(21): 9543 - 9553.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
H. Schneider, E. Valk, S. da Rocha Dias, B. Wei, and C. E. Rudd
CTLA-4 up-regulation of lymphocyte function-associated antigen 1 adhesion and clustering as an alternate basis for coreceptor function
PNAS, September 6, 2005; 102(36): 12861 - 12866.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
S. Mukherjee, A. Ahmed, and D. Nandi
CTLA4-CD80/CD86 interactions on primary mouse CD4+ T cells integrate signal-strength information to modulate activation with Concanavalin A
J. Leukoc. Biol., July 1, 2005; 78(1): 144 - 157.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
S. Chikuma, A. K. Abbas, and J. A. Bluestone
B7-Independent Inhibition of T Cells by CTLA-4
J. Immunol., July 1, 2005; 175(1): 177 - 181.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
T. J. Dillon, K. D. Carey, S. A. Wetzel, D. C. Parker, and P. J. S. Stork
Regulation of the Small GTPase Rap1 and Extracellular Signal-Regulated Kinases by the Costimulatory Molecule CTLA-4
Mol. Cell. Biol., May 15, 2005; 25(10): 4117 - 4128.
[Abstract] [Full Text] [PDF]


Home page
BloodHome page
J. L. Riley and C. H. June
The CD28 family: a T-cell rheostat for therapeutic control of T-cell activation
Blood, January 1, 2005; 105(1): 13 - 21.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
K. W. Hwang, W. B. Sweatt, M. Mashayekhi, D. A. Palucki, H. Sattar, E. Chuang, and M.-L. Alegre
Transgenic Expression of CTLA-4 Controls Lymphoproliferation in IL-2-Deficient Mice
J. Immunol., November 1, 2004; 173(9): 5415 - 5424.
[Abstract] [Full Text] [PDF]


Home page
Int ImmunolHome page
W. Stohl, D. Xu, K. S. Kim, C. S. David, and J. P. Allison
MHC class II-independent and -dependent T cell expansion and B cell hyperactivity in vivo in mice deficient in CD152 (CTLA-4)
Int. Immunol., July 1, 2004; 16(7): 895 - 904.
[Abstract] [Full Text] [PDF]


Home page
Int ImmunolHome page
L. A. Yi, S. Hajialiasgar, and E. Chuang
Tyrosine-mediated inhibitory signals contribute to CTLA-4 function in vivo
Int. Immunol., April 1, 2004; 16(4): 539 - 547.
[Abstract] [Full Text] [PDF]


Home page
JEMHome page
S. Chikuma, J. B. Imboden, and J. A. Bluestone
Negative Regulation of T Cell Receptor-Lipid Raft Interaction by Cytotoxic T Lymphocyte-associated Antigen 4
J. Exp. Med., January 6, 2003; 197(1): 129 - 135.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
S. Mukherjee, P. K. Maiti, and D. Nandi
Role of CD80, CD86, and CTLA4 on mouse CD4+ T lymphocytes in enhancing cell-cycle progression and survival after activation with PMA and ionomycin
J. Leukoc. Biol., November 1, 2002; 72(5): 921 - 931.
[Abstract] [Full Text] [PDF]


Home page
Mol. Interv.Home page
S. Chikuma and J. A. Bluestone
CTLA-4: Acting at the Synapse
Mol. Interv., July 1, 2002; 2(4): 205 - 208.
[Abstract] [Full Text] [PDF]


Home page
BloodHome page
C. A. Chambers, J. Kang, Y. Wu, W. Held, D. H. Raulet, and J. P. Allison
The lymphoproliferative defect in CTLA-4-deficient mice is ameliorated by an inhibitory NK cell receptor
Blood, May 29, 2002; 99(12): 4509 - 4516.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
M. L. Baroja, L. Vijayakrishnan, E. Bettelli, P. J. Darlington, T. A. Chau, V. Ling, M. Collins, B. M. Carreno, J. Madrenas, and V. K. Kuchroo
Inhibition of CTLA-4 Function by the Regulatory Subunit of Serine/Threonine Phosphatase 2A
J. Immunol., May 15, 2002; 168(10): 5070 - 5078.
[Abstract] [Full Text] [PDF]


Home page
JEMHome page
A. M. Doyle, A. C. Mullen, A. V. Villarino, A. S. Hutchins, F. A. High, H. W. Lee, C. B. Thompson, and S. L. Reiner
Induction of Cytotoxic T Lymphocyte Antigen 4 (Ctla-4) Restricts Clonal Expansion of Helper T Cells
J. Exp. Med., October 1, 2001; 194(7): 893 - 902.
[Abstract] [Full Text] [PDF]


Home page
JEMHome page
S. Mirshahidi, C.-T. Huang, and S. Sadegh-Nasseri
Anergy in Peripheral Memory Cd4+ T Cells Induced by Low Avidity Engagement of T Cell Receptor
J. Exp. Med., September 17, 2001; 194(6): 719 - 732.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
M.-N. Avice, M. Rubio, M. Sergerie, G. Delespesse, and M. Sarfati
Role of CD47 in the Induction of Human Naive T Cell Anergy
J. Immunol., September 1, 2001; 167(5): 2459 - 2468.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow Request Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Masteller, E. L.
Right arrow Articles by Thompson, C. B.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Masteller, E. L.
Right arrow Articles by Thompson, C. B.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS